DC900201

Overview
NameDC900201
Unique NameDC900201
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length804
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5643 contig Csv1_Contig5643:1..805. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATH_RAT (Cathepsin H OS=Rattus norvegicus GN=Ctsh PE=1 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 8.675e-37
Identity = 86/202 (42.57%), Postives = 117/202 (57.92%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTD-QNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVA-KQPVSVAIDAGSSDFQFYSEGVFTG----ECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            CGSCW FST  A+E    I + K+++L+EQ+LVDC  +  N GC GGL   AFE+I    G+  E  YPY   +G C  + E + A  +    N+  N E A+++AVA   PVS A +  + DF  Y  GV++     +   ++NH V AVGYG   +G  YWIV+NSWG  WG  GY  ++RG    K +CG+A  ASYPI
Sbjct:  136 CGSCWTFSTTGALESAVAIASGKMMTLAEQQLVDCAQNFNNHGCQGGLPSQAFEYILYNKGIMGEDSYPYIGKNGQCKFNPEKAVAF-VKNVVNITLNDEAAMVEAVALYNPVSFAFEV-TEDFMMYKSGVYSSNSCHKTPDKVNHAVLAVGYGEQ-NGLLYWIVKNSWGSNWGNNGYFLIERG----KNMCGLAACASYPI 330          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATH_MOUSE (Cathepsin H OS=Mus musculus GN=Ctsh PE=2 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.133e-36
Identity = 86/202 (42.57%), Postives = 117/202 (57.92%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDC-DTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVA-KQPVSVAIDAGSSDFQFYSEGVFTG----ECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            C SCW FST  A+E    I + K++SL+EQ+LVDC     N GC GGL   AFE+I    G+  E  YPY   D +C  + + + A  +    N+  N E A+++AVA   PVS A +  + DF  Y  GV++     +   ++NH V AVGYG   +G  YWIV+NSWG +WGE GY  ++RG    K +CG+A  ASYPI
Sbjct:  136 CASCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAF-VKNVVNITLNDEAAMVEAVALYNPVSFAFEV-TEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQ-NGLLYWIVKNSWGSQWGENGYFLIERG----KNMCGLAACASYPI 330          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: LMCPB_LEIME (Cysteine proteinase B OS=Leishmania mexicana GN=LMCPB PE=2 SV=2)

HSP 1 Score: 152.525 bits (384), Expect = 2.524e-36
Identity = 86/219 (39.27%), Postives = 122/219 (55.71%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFI--KKKGGVTTEAKYPYQANDG---TCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQ-PVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKSATNPTGPSDYPKDE 654
            CGSCWAFS +  +EG  ++  ++LVSLSEQ+LV CD D N GC+GGLM  AF+++     G + TE  YPY + +G    C  S E      IDGH  +  + E A+   +AK  P+++A+DA  S F  Y  GV T   G +LNHGV  VGY  T +   YW+++NSWG +WGE+GY+R+  G++         + + YP+         P      E
Sbjct:  147 CGSCWAFSAVGNIEGQWYLAGHELVSLSEQQLVSCD-DMNDGCDGGLMLQAFDWLLQNTNGHLHTEDSYPYVSGNGYVPECSNSSELVVGAQIDGHVLI-GSSEKAMAAWLAKNGPIAIALDA--SSFMSYKSGVLTACIGKQLNHGVLLVGYDMTGE-VPYWVIKNSWGGDWGEQGYVRVVMGVN-------ACLLSEYPVSAHVRESAAPGTSTSSE 353          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CYSP1_DICDI (Cysteine proteinase 1 OS=Dictyostelium discoideum GN=cprA PE=1 SV=2)

HSP 1 Score: 152.525 bits (384), Expect = 2.524e-36
Identity = 85/204 (41.67%), Postives = 113/204 (55.39%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTD---------QNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECG-TELNHGVAAVGYGTT----LDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIA 582
            +CGSCW+FST   VEG + I  NKLVSLSEQ LVDCD +          ++GCNGGL   A+ +I K GG+ TE+ YPY A  GT      ++    I     +P N        V+  P+++A DA   ++QFY  GVF   C    L+HG+  VGY            YWIV+NSWG +WGE+GYI ++RG    K  CG++
Sbjct:  138 QCGSCWSFSTTGNVEGQHFISQNKLVSLSEQNLVDCDHECMEYEGEQACDEGCNGGLQPNAYNYIIKNGGIQTESSYPYTAETGTQCNFNSANIGAKISNFTMIPKNETVMAGYIVSTGPLAIAADA--VEWQFYIGGVFDIPCNPNSLDHGILIVGYSAKNTIFRKNMPYWIVKNSWGADWGEQGYIYLRRG----KNTCGVS 335          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATL_BRUPA (Cathepsin L-like OS=Brugia pahangi PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 3.297e-36
Identity = 85/200 (42.50%), Postives = 120/200 (60.00%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ-NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQ-PVSVAIDAGSSDFQFYSEGVFT-GECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            ECGSC+AF+T AA+E  +  MT +L+ LS Q +VDC  +  N GC+GG M  AF++  + G +  E++YPY   +  C   ++S   V+ +G   +    E AL  AVAK+ PV V I      F+FY +GV++ G CG   +H V AVGYGT      YWIV+NSWG +WG+ GY+ M R   ++  +C IA  AS+PI
Sbjct:  202 ECGSCYAFATAAALEAYHKQMTGRLLDLSPQNIVDCTRNLGNNGCSGGYMPTAFQYASRYG-IAMESRYPYVGTEQRCRW-QQSIAVVTDNGFNEIQPGDELALKHAVAKRGPVVVGISGSKRSFRFYKDGVYSEGNCGRP-DHAVLAVGYGTHPSYGDYWIVKNSWGTDWGKDGYVYMAR---NRGNMCHIASAASFPI 395          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: ACP1_ENTHI (Cysteine proteinase ACP1 OS=Entamoeba histolytica GN=ACP1 PE=1 SV=2)

HSP 1 Score: 151.369 bits (381), Expect = 5.623e-36
Identity = 82/200 (41.00%), Postives = 113/200 (56.50%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQ-PVSVAIDAGSSDFQFYSEGVFTGE--CGTE-LNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCW F T A +EG  +    KL S SEQ+LVDCD   N GC GG    + +FI++  G+  E+ YPY+A  GTC   K+     ++ G   V    E  L   +A+  PV+V +DA    FQ Y +G    +  C +  +NH V AVGYG+  +G KYWI+RNSWG  WG+ GY  + R   D   +CGI  +++YP
Sbjct:  111 QCGSCWTFCTTAVLEGRVNKDLGKLYSFSEQQLVDCDASDN-GCEGGHPSNSLKFIQENNGLGLESDYPYKAVAGTC---KKVKNVATVTGSRRVTDGSETGLQTIIAENGPVAVGMDASRPSFQLYKKGTIYSDTKCRSRMMNHCVTAVGYGSNSNG-KYWIIRNSWGTSWGDAGYFLLAR---DSNNMCGIGRDSNYP 302          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATQ_RAT (Cathepsin Q OS=Rattus norvegicus GN=Ctsq PE=2 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.253e-35
Identity = 81/201 (40.30%), Postives = 115/201 (57.21%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ-NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVA-KQPVSVAIDAGSSDFQFYSEGVF-TGECGTELNHGVAAVGYG---TTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            C SCWAF    A+EG     T KL+ LS Q L+DC   Q N+GC  G    AF+++   GG+  EA YPY+  +G C  + ++S A  I G   +P + ED L+ AVA K P++  +   SS F+FY +GV+   +C + +NH V  VGYG      DG  YW+++NSWG  WG +GY+++ +   D+   C IA  A YP
Sbjct:  146 CSSCWAFPVTGAIEGQMFKKTGKLIPLSVQNLIDCSKPQGNRGCLWGNTYNAFQYVLHNGGLEAEATYPYERKEGVCRYNPKNSSA-KITGFVVLPES-EDVLMDAVATKGPIATGVHVISSSFRFYQKGVYHEPKCSSYVNHAVLVVGYGFEGNETDGNNYWLIKNSWGKRWGLRGYMKIAK---DRNNHCAIASLAQYP 341          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CYSP2_LEIPI (Cysteine proteinase 2 OS=Leishmania pifanoi GN=CYS2 PE=1 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 2.137e-35
Identity = 85/220 (38.64%), Postives = 123/220 (55.91%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFI--KKKGGVTTEAKYPYQANDG----TCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQ-PVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKSATNPTGPSDYPKDE 654
            CGSCWAFS +  +EG  ++  ++LVSLSEQ+LV CD D N GC+GGLM  AF+++     G + TE  YPY + +G      + S+E      IDGH  +  + E A+   +AK  P+++A+DA  S F  Y  GV T   G +LNHGV  VGY  T +   YW+++NSWG +WGE+GY+R+  G++         + + YP+         P      E
Sbjct:  147 CGSCWAFSAVGNIEGQWYLAGHELVSLSEQQLVSCD-DMNDGCDGGLMLQAFDWLLQNTNGHLHTEDSYPYVSGNGYVPECSNSSEELVVGAQIDGHVLI-GSSEKAMAAWLAKNGPIAIALDA--SSFMSYKSGVLTACIGKQLNHGVLLVGYDMTGE-VPYWVIKNSWGGDWGEQGYVRVVMGVN-------ACLLSEYPVSAHVRESAAPGTSTSSE 354          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATLL_PHACE (Cathepsin L-like proteinase OS=Phaedon cochleariae PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.791e-35
Identity = 84/201 (41.79%), Postives = 114/201 (56.72%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ-NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGVFTGE--CGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            ECGSCWA ST AA+E  + I +   V LS Q+LVDC T   N GCNGG     FE++ K  G+ ++A YPY   +  C  + +S   V + G++ V A+ E +L +AV    P+S  +       + Y  G+F      G  L+HGV  VGYG   +G KYWI++N+WG +WGE GYIR+   I D    CG+   ASYPI
Sbjct:  130 ECGSCWALSTAAAIESQSAIKSGSKVPLSPQQLVDCSTSYGNHGCNGGFAVNGFEYV-KDNGLESDADYPYSGKEDKCKANDKSRSVVELTGYKKVTAS-ETSLKEAVGTIGPISAVV--FGKPMKSYGGGIFDDSSCLGDNLHHGVNVVGYGIE-NGQKYWIIKNTWGADWGESGYIRL---IRDTDHSCGVEKMASYPI 322          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CYSP_THEAN (Cysteine proteinase OS=Theileria annulata GN=TACP PE=2 SV=2)

HSP 1 Score: 148.673 bits (374), Expect = 3.645e-35
Identity = 90/203 (44.33%), Postives = 120/203 (59.11%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLD-GTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGL--CGIAMEASYPIKKSA 615
            CGSCWAFS+IA+VE +  +  NK   LSEQELV+CD   + GC GGL   A E+I  K GV+ E++ PY      C  S ++   V ID    +  N  D + K++   P  V I A + + + YS G+FTG+CG ELNH V  VG G   + G +YWI++NSWG +WGE G++R+QR    KKGL  CGI      PI  S+
Sbjct:  249 CGSCWAFSSIASVESLYRLYKNKSYFLSEQELVNCD-KSSMGCAGGLPITALEYIHSK-GVSFESEVPYTGIVSPCKPSIKNK--VFIDSISILKGN--DVVNKSLVISPTVVGI-AVTKELKLYSGGIFTGKCGGELNHAVLLVGEGVDHETGMRYWIIKNSWGEDWGENGFLRLQR---TKKGLDKCGILTFGLNPILYSS 441          
The following BLAST results are available for this feature:
BLAST of DC900201 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 179
Match NameE-valueIdentityDescription
CATH_RAT8.675e-3742.57Cathepsin H OS=Rattus norvegicus GN=Ctsh PE=1 SV=1[more]
CATH_MOUSE1.133e-3642.57Cathepsin H OS=Mus musculus GN=Ctsh PE=2 SV=1[more]
LMCPB_LEIME2.524e-3639.27Cysteine proteinase B OS=Leishmania mexicana GN=LM... [more]
CYSP1_DICDI2.524e-3641.67Cysteine proteinase 1 OS=Dictyostelium discoideum ... [more]
CATL_BRUPA3.297e-3642.50Cathepsin L-like OS=Brugia pahangi PE=1 SV=1[more]
ACP1_ENTHI5.623e-3641.00Cysteine proteinase ACP1 OS=Entamoeba histolytica ... [more]
CATQ_RAT1.253e-3540.30Cathepsin Q OS=Rattus norvegicus GN=Ctsq PE=2 SV=1[more]
CYSP2_LEIPI2.137e-3538.64Cysteine proteinase 2 OS=Leishmania pifanoi GN=CYS... [more]
CATLL_PHACE2.791e-3541.79Cathepsin L-like proteinase OS=Phaedon cochleariae... [more]
CYSP_THEAN3.645e-3544.33Cysteine proteinase OS=Theileria annulata GN=TACP ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900201 VSS Citrus sinensis cDNA clone VS28238 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900201 ID=DC900201|Name=DC900201|organism=Citrus sinensis|type=EST|length=804bp
AATTCGGCACGAGAATGCGGTAGCTGCTGGGCTTTTTCAACAATTGCAGC
AGTAGAGGGCATTAATCACATTATGACAAATAAGCTCGTTTCTTTGTCTG
AGCAAGAGTTAGTTGATTGTGACACTGATCAAAACCAAGGATGTAATGGA
GGGCTAATGGAATTGGCATTTGAGTTCATCAAGAAAAAGGGTGGCGTAAC
AACAGAGGCTAAGTACCCTTACCAAGCTAATGATGGAACATGTGACGTTT
CAAAGGAAAGTTCCCCAGCAGTGTCAATTGACGGACATGAAAATGTACCT
GCTAATCACGAGGATGCTCTGCTTAAGGCAGTTGCAAAACAGCCTGTGTC
AGTAGCCATAGATGCCGGCAGTTCAGATTTCCAGTTCTATTCAGAGGGTG
TATTTACTGGAGAATGTGGCACAGAGCTGAATCATGGAGTTGCAGCTGTG
GGCTACGGTACAACACTCGATGGAACCAAGTATTGGATAGTGAGGAACTC
ATGGGGACCTGAATGGGGAGAGAAGGGTTACATCAGAATGCAGCGCGGCA
TCTCAGACAAAAAGGGACTCTGTGGTATTGCAATGGAAGCTTCATATCCC
ATCAAGAAATCTGCAACAAACCCAACAGGACCTTCAGATTATCCTAAGGA
TGAGCTCTAGACACGGTTCACTATTGTCTTTGGCTTTTCTCTGCATTTCA
AGCTCAGCGGTTATCTCTTCTGTGTTAAAGTTGCATGTAATATGCCCTTG
TGATTCATGATTGAATAATGTTTCGATTTATGCAAATAAAGCCAACATTT
TACA
back to top