DC900196

Overview
NameDC900196
Unique NameDC900196
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length730
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7124 contig Csv1_Contig7124:970..1699. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: ERF3_SCHPO (Eukaryotic peptide chain release factor GTP-binding subunit OS=Schizosaccharomyces pombe GN=sup35 PE=1 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 6.923e-11
Identity = 37/120 (30.83%), Postives = 61/120 (50.83%), Query Frame = 2
Query:   38 QRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNV 397
            Q G       +P      F +Q+ I+  P  +  GY+ V+  HT+   V F++L+ K+D+ + K  +K P F   G   + ++    P+ +E F DY  +GRF +RD   TVAVG +  +
Sbjct:  542 QTGYVLTSTKNPVHATTRFIAQIAILELPSILTTGYSCVMHIHTAVEEVSFAKLLHKLDKTNRKS-KKPPMFATKGMKIIAELETQTPVCMERFEDYQYMGRFTLRDQGTTVAVGKVVKI 660          
The following BLAST results are available for this feature:
BLAST of DC900196 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 171
Match NameE-valueIdentityDescription
ERF3_SCHPO6.923e-1130.83Eukaryotic peptide chain release factor GTP-bindin... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900196 VSS Citrus sinensis cDNA clone VS28233 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900196 ID=DC900196|Name=DC900196|organism=Citrus sinensis|type=EST|length=730bp
CAATGTGGCTCAACGTAAGAACGTGCTGCAAGGATCCCAGCGTGGTTTGT
GCTNCCAACCGAAGGATGATCCGGCCAGGNAAGCTGCCAACTTCACCTCA
CAGGTCATCATCATGAACCACCCTGGCCAGATTGGAAATGGATATGCCCC
AGTGCTTGACTGCCACACCTCCCACATTGCCGTCAAGTTTTCTGAGCTCG
TGACGAAGATTGATAGGCGATCAGGCAAGGAGCTTGAGAAGGAGCCCAAG
TTCTTGAAGAATGGAGATGCTGGAATGGTTAAGATGATTCCCACCAAGCC
CATGGTTGTTGAAACCTTCTCTGACTACCCACCTCTTGGTCGTTTTGCCG
TTAGGGACATGCGTCAGACTGTTGCTGTTGGTGTGATTAAGAATGTTGAA
AAGAAGGATCCAACAGGTGCCAAGGTCACCAAGTCTGCAGCCAAGAAGAA
GTGAATCGGGTTGGTTAATGTTGCTTTATCCGCAGATGGAGTCTATTTTA
ATAATTGTAGTTATACAAACTTGGTTATTTTTGGTACTGTTATAGTTCGA
TGCATGCTTTCCTTTTTAGGTTTTAGTTTGTTGCCTTTGGTGTCGGGTAN
NGATTCCCAGAATTGGGTGCTTGACAGGCGGTGGCGCAGCTCTAACCTGG
AGTCTCAATTTTATTAATAGTTATGGTCTTTGTTTGTATTGATACTTGAG
GTGGTTCGGTTTCATCTGAATCGGCTCAGA
back to top