DC900196

Overview
NameDC900196
Unique NameDC900196
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length730
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7124 contig Csv1_Contig7124:970..1699. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_CHICK (Elongation factor 1-alpha 1 OS=Gallus gallus GN=EEF1A PE=2 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.131e-45
Identity = 93/130 (71.54%), Postives = 106/130 (81.54%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            K+V +G+  G     K+DP   AA FT+QVII+NHPGQI  GYAPVLDCHT+HIA KF+EL  KIDRRSGK+LE  PKFLK+GDA +V MIP KPM VE+FSDYPPLGRFAVRDMRQTVAVGVIK V+KK
Sbjct:  318 KDVRRGNVAG---DSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMIPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKK 444          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1AC_PORPU (Elongation factor 1-alpha C OS=Porphyra purpurea GN=TEF-C PE=2 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.131e-45
Identity = 90/136 (66.18%), Postives = 111/136 (81.62%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +C   K+DP +  A+F +QVII+NHPG+I  GYAPVLDCHT+HIA KFSEL+ K+DRRSGK+LE  PK +K+GDA MVKM+ +KPM VE F+ YPPLGRFAVRDMRQTVAVGVIK+VEKK+  G
Sbjct:  305 KNVSVKDLKRGYVCGDSKNDPPKGCASFNAQVIILNHPGEIHAGYAPVLDCHTAHIACKFSELILKMDRRSGKKLEDSPKMIKSGDAAMVKMVASKPMCVEAFTSYPPLGRFAVRDMRQTVAVGVIKSVEKKEVEG 440          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_TRIRE (Elongation factor 1-alpha OS=Trichoderma reesei GN=tef1 PE=3 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.477e-45
Identity = 88/129 (68.22%), Postives = 106/129 (82.17%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEK 403
            K + +G+  G     K+DP   AA+FT+QVI+MNHPGQ+G GYAPVLDCHT+HIA KF+EL+ KIDRR+GK  E  PKF+K+GD+ +VKMIP+KPM VE F+DYPPLGRFAVRDMRQTVAVGVIK VEK
Sbjct:  317 KEIRRGNVAG---DSKNDPPMGAASFTAQVIVMNHPGQVGAGYAPVLDCHTAHIACKFAELLEKIDRRTGKATESAPKFIKSGDSAIVKMIPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKAVEK 442          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_PORYE (Elongation factor 1-alpha OS=Porphyra yezoensis PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.477e-45
Identity = 90/136 (66.18%), Postives = 111/136 (81.62%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +C   K+DP +  A+F +QVII+NHPG+I  GYAPVLDCHT+HIA KFSEL+ K+DRRSGK+LE  PK +K+GDA MVKM+ +KPM VE F+ YPPLGRFAVRDMRQTVAVGVIK+VEKK+  G
Sbjct:  305 KNVSVKDLKRGYVCGDSKNDPPKGCASFNAQVIILNHPGEIHAGYAPVLDCHTAHIACKFSELILKMDRRSGKKLEDTPKMIKSGDAAMVKMVASKPMCVEAFTQYPPLGRFAVRDMRQTVAVGVIKSVEKKEVEG 440          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_NEUCR (Elongation factor 1-alpha OS=Neurospora crassa GN=tef-1 PE=3 SV=2)

HSP 1 Score: 182.956 bits (463), Expect = 1.477e-45
Identity = 87/129 (67.44%), Postives = 108/129 (83.72%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEK 403
            K++ +G+  G     K+DP   AA+FT+QVI++NHPGQ+G GYAPVLDCHT+HIA KF+EL+ KIDRR+GK +E  PKF+K+GDA +VKMIP+KPM VE F+DYPPLGRFAVRDMRQTVAVGVIK V+K
Sbjct:  317 KDIRRGNVAG---DSKNDPPAGAASFTAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFAELLEKIDRRTGKAVEASPKFIKSGDAAIVKMIPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKAVDK 442          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A1_RAT (Elongation factor 1-alpha 1 OS=Rattus norvegicus GN=Eef1a1 PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.477e-45
Identity = 92/130 (70.77%), Postives = 106/130 (81.54%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            K+V +G+  G     K+DP   AA FT+QVII+NHPGQI  GYAPVLDCHT+HIA KF+EL  KIDRRSGK+LE  PKFLK+GDA +V M+P KPM VE+FSDYPPLGRFAVRDMRQTVAVGVIK V+KK
Sbjct:  318 KDVRRGNVAG---DSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKK 444          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A1_RABIT (Elongation factor 1-alpha 1 OS=Oryctolagus cuniculus GN=EEF1A1 PE=1 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.477e-45
Identity = 92/130 (70.77%), Postives = 106/130 (81.54%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            K+V +G+  G     K+DP   AA FT+QVII+NHPGQI  GYAPVLDCHT+HIA KF+EL  KIDRRSGK+LE  PKFLK+GDA +V M+P KPM VE+FSDYPPLGRFAVRDMRQTVAVGVIK V+KK
Sbjct:  318 KDVRRGNVAG---DSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKK 444          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A1_PONAB (Elongation factor 1-alpha 1 OS=Pongo abelii GN=EEF1A1 PE=2 SV=2)

HSP 1 Score: 182.956 bits (463), Expect = 1.477e-45
Identity = 92/130 (70.77%), Postives = 106/130 (81.54%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            K+V +G+  G     K+DP   AA FT+QVII+NHPGQI  GYAPVLDCHT+HIA KF+EL  KIDRRSGK+LE  PKFLK+GDA +V M+P KPM VE+FSDYPPLGRFAVRDMRQTVAVGVIK V+KK
Sbjct:  318 KDVRRGNVAG---DSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKK 444          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A1_PANTR (Elongation factor 1-alpha 1 OS=Pan troglodytes GN=EEF1A1 PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.477e-45
Identity = 92/130 (70.77%), Postives = 106/130 (81.54%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            K+V +G+  G     K+DP   AA FT+QVII+NHPGQI  GYAPVLDCHT+HIA KF+EL  KIDRRSGK+LE  PKFLK+GDA +V M+P KPM VE+FSDYPPLGRFAVRDMRQTVAVGVIK V+KK
Sbjct:  318 KDVRRGNVAG---DSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKK 444          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A1_MOUSE (Elongation factor 1-alpha 1 OS=Mus musculus GN=Eef1a1 PE=1 SV=3)

HSP 1 Score: 182.956 bits (463), Expect = 1.477e-45
Identity = 92/130 (70.77%), Postives = 106/130 (81.54%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            K+V +G+  G     K+DP   AA FT+QVII+NHPGQI  GYAPVLDCHT+HIA KF+EL  KIDRRSGK+LE  PKFLK+GDA +V M+P KPM VE+FSDYPPLGRFAVRDMRQTVAVGVIK V+KK
Sbjct:  318 KDVRRGNVAG---DSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKK 444          
The following BLAST results are available for this feature:
BLAST of DC900196 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 171
Match NameE-valueIdentityDescription
EF1A_CHICK1.131e-4571.54Elongation factor 1-alpha 1 OS=Gallus gallus GN=EE... [more]
EF1AC_PORPU1.131e-4566.18Elongation factor 1-alpha C OS=Porphyra purpurea G... [more]
EF1A_TRIRE1.477e-4568.22Elongation factor 1-alpha OS=Trichoderma reesei GN... [more]
EF1A_PORYE1.477e-4566.18Elongation factor 1-alpha OS=Porphyra yezoensis PE... [more]
EF1A_NEUCR1.477e-4567.44Elongation factor 1-alpha OS=Neurospora crassa GN=... [more]
EF1A1_RAT1.477e-4570.77Elongation factor 1-alpha 1 OS=Rattus norvegicus G... [more]
EF1A1_RABIT1.477e-4570.77Elongation factor 1-alpha 1 OS=Oryctolagus cunicul... [more]
EF1A1_PONAB1.477e-4570.77Elongation factor 1-alpha 1 OS=Pongo abelii GN=EEF... [more]
EF1A1_PANTR1.477e-4570.77Elongation factor 1-alpha 1 OS=Pan troglodytes GN=... [more]
EF1A1_MOUSE1.477e-4570.77Elongation factor 1-alpha 1 OS=Mus musculus GN=Eef... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900196 VSS Citrus sinensis cDNA clone VS28233 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900196 ID=DC900196|Name=DC900196|organism=Citrus sinensis|type=EST|length=730bp
CAATGTGGCTCAACGTAAGAACGTGCTGCAAGGATCCCAGCGTGGTTTGT
GCTNCCAACCGAAGGATGATCCGGCCAGGNAAGCTGCCAACTTCACCTCA
CAGGTCATCATCATGAACCACCCTGGCCAGATTGGAAATGGATATGCCCC
AGTGCTTGACTGCCACACCTCCCACATTGCCGTCAAGTTTTCTGAGCTCG
TGACGAAGATTGATAGGCGATCAGGCAAGGAGCTTGAGAAGGAGCCCAAG
TTCTTGAAGAATGGAGATGCTGGAATGGTTAAGATGATTCCCACCAAGCC
CATGGTTGTTGAAACCTTCTCTGACTACCCACCTCTTGGTCGTTTTGCCG
TTAGGGACATGCGTCAGACTGTTGCTGTTGGTGTGATTAAGAATGTTGAA
AAGAAGGATCCAACAGGTGCCAAGGTCACCAAGTCTGCAGCCAAGAAGAA
GTGAATCGGGTTGGTTAATGTTGCTTTATCCGCAGATGGAGTCTATTTTA
ATAATTGTAGTTATACAAACTTGGTTATTTTTGGTACTGTTATAGTTCGA
TGCATGCTTTCCTTTTTAGGTTTTAGTTTGTTGCCTTTGGTGTCGGGTAN
NGATTCCCAGAATTGGGTGCTTGACAGGCGGTGGCGCAGCTCTAACCTGG
AGTCTCAATTTTATTAATAGTTATGGTCTTTGTTTGTATTGATACTTGAG
GTGGTTCGGTTTCATCTGAATCGGCTCAGA
back to top