DC900196

Overview
NameDC900196
Unique NameDC900196
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length730
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7124 contig Csv1_Contig7124:970..1699. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_DANRE (Elongation factor 1-alpha OS=Danio rerio GN=eef1a PE=2 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 3.290e-45
Identity = 90/130 (69.23%), Postives = 106/130 (81.54%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            K++ +G+  G     K+DP   AANF +QVII+NHPGQI  GYAPVLDCHT+HIA KF+EL  KIDRRSGK+LE  PK LK+GDA +V+M+P KPM VE+FS YPPLGRFAVRDMRQTVAVGVIK+VEKK
Sbjct:  318 KDIRRGNVAG---DSKNDPPMEAANFNAQVIILNHPGQISQGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKALKSGDAAIVEMVPGKPMCVESFSTYPPLGRFAVRDMRQTVAVGVIKSVEKK 444          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_PODCU (Elongation factor 1-alpha OS=Podospora curvicolla GN=TEF PE=3 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 5.611e-45
Identity = 86/129 (66.67%), Postives = 107/129 (82.95%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEK 403
            K + +G+  G     K+DP   AA+F +QVI++NHPGQ+G GYAPVLDCHT+HIA KF+EL+ KIDRR+GK +E+ PKF+K+GDA +VKMIP+KPM VE F++YPPLGRFAVRDMRQTVAVGVIK VEK
Sbjct:  317 KEIRRGNVAG---DSKNDPPLGAASFDAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFAELLQKIDRRTGKAVEESPKFIKSGDAAIVKMIPSKPMCVEAFTEYPPLGRFAVRDMRQTVAVGVIKKVEK 442          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A2_SCHPO (Elongation factor 1-alpha-B/C OS=Schizosaccharomyces pombe GN=tef1b PE=1 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 5.611e-45
Identity = 89/134 (66.42%), Postives = 110/134 (82.09%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 412
            KNV ++  +RG +C   K+DP    A+FT+QVII+NHPGQI  GY+PVLDCHT+HIA KF+EL+ KIDRRSGK++E+ PKF+K+GDA + KM+P+KPM VE F+DY PLGRFAVRDMRQTVAVGVIK VEK  P
Sbjct:  311 KNVSVKDIRRGNVCGDSKNDPPMGCASFTAQVIILNHPGQISAGYSPVLDCHTAHIACKFAELIEKIDRRSGKKIEESPKFVKSGDACIAKMVPSKPMCVEAFTDYAPLGRFAVRDMRQTVAVGVIKAVEKVAP 444          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A1_SCHPO (Elongation factor 1-alpha-A OS=Schizosaccharomyces pombe GN=tef1a PE=1 SV=2)

HSP 1 Score: 181.03 bits (458), Expect = 5.611e-45
Identity = 89/134 (66.42%), Postives = 110/134 (82.09%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 412
            KNV ++  +RG +C   K+DP    A+FT+QVII+NHPGQI  GY+PVLDCHT+HIA KF+EL+ KIDRRSGK++E+ PKF+K+GDA + KM+P+KPM VE F+DY PLGRFAVRDMRQTVAVGVIK VEK  P
Sbjct:  311 KNVSVKDIRRGNVCGDSKNDPPMGCASFTAQVIILNHPGQISAGYSPVLDCHTAHIACKFAELIEKIDRRSGKKIEESPKFVKSGDACIAKMVPSKPMCVEAFTDYAPLGRFAVRDMRQTVAVGVIKAVEKVAP 444          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A3_HUMAN (Putative elongation factor 1-alpha-like 3 OS=Homo sapiens GN=EEF1AL3 PE=5 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 7.328e-45
Identity = 91/130 (70.00%), Postives = 105/130 (80.77%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            K+V +G+  G     K+DP   AA FT+QVII+NHPGQI  GYAPVLDCH +HIA KF+EL  KIDRRSGK+LE  PKFLK+GDA +V M+P KPM VE+FSDYPPLGRFAVRDMRQTVAVGVIK V+KK
Sbjct:  318 KDVRRGNVAG---DSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHMAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKK 444          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A1_HORSE (Elongation factor 1-alpha 1 OS=Equus caballus GN=EEF1A1 PE=2 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 9.571e-45
Identity = 91/130 (70.00%), Postives = 105/130 (80.77%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            K+V +G+  G     K+DP   AA FT+QVII+NHPGQI  GYAPV DCHT+HIA KF+EL  KIDRRSGK+LE  PKFLK+GDA +V M+P KPM VE+FSDYPPLGRFAVRDMRQTVAVGVIK V+KK
Sbjct:  318 KDVRRGNVAG---DSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVPDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKK 444          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_CRYNE (Elongation factor 1-alpha OS=Cryptococcus neoformans GN=TEF1 PE=2 SV=2)

HSP 1 Score: 179.874 bits (455), Expect = 1.250e-44
Identity = 86/136 (63.24%), Postives = 111/136 (81.62%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +C   K+DP   AA+F +QVI++NHPGQIG GY PVLDCHT+HIA KF+EL+ KIDRR+GK +E  PKF+K+GDA +VK++  KP+ VET++DYPPLGRFAVRDMRQTVAVGVIK+V+K +  G
Sbjct:  311 KNVSIKDIRRGNVCGDSKNDPPMEAASFNAQVIVLNHPGQIGAGYTPVLDCHTAHIACKFAELIEKIDRRTGKVMEAAPKFVKSGDAAIVKLVAQKPLCVETYADYPPLGRFAVRDMRQTVAVGVIKSVDKTEKGG 446          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_ARXAD (Elongation factor 1-alpha OS=Arxula adeninivorans GN=TEF PE=3 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.250e-44
Identity = 86/131 (65.65%), Postives = 106/131 (80.92%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKD 409
            K + +G+  G     K+DP +   +FT+QVII NHPGQI  GY+PVLDCHT+HIA +F EL+ KIDRRSGK++E  PKF+K GDA +V+MIP+KPM VETF++YPPLGRFAVRDMRQTVAVGVIK+VEK D
Sbjct:  316 KEIRRGNVAG---DSKNDPPKGCDSFTAQVIIFNHPGQISAGYSPVLDCHTAHIACRFDELIEKIDRRSGKKVEDSPKFVKAGDAAIVRMIPSKPMCVETFTEYPPLGRFAVRDMRQTVAVGVIKSVEKSD 443          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_STYLE (Elongation factor 1-alpha OS=Stylonychia lemnae GN=EFAA PE=3 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 2.785e-44
Identity = 81/119 (68.07%), Postives = 100/119 (84.03%), Query Frame = 2
Query:   62 KDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            K+DPA+   NF +QVI++NHPGQI  GYAPVLDCHT+HIA KF E+ +K+DRRSGK LE+EPKF+K+G+A +V+M+P KPM VE F+ YPPLGRFAVRDM+QTVAVGVIK V KK+  G
Sbjct:  318 KNDPAKDTTNFLAQVIVLNHPGQIQKGYAPVLDCHTAHIACKFDEIESKVDRRSGKVLEEEPKFIKSGEAALVRMVPQKPMCVEAFNQYPPLGRFAVRDMKQTVAVGVIKEVVKKEQKG 436          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_EUGGR (Elongation factor 1-alpha OS=Euglena gracilis GN=TEF PE=2 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 2.785e-44
Identity = 92/136 (67.65%), Postives = 111/136 (81.62%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +    K+DPA+ AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KF+ + TKIDRRSGKELE EPKF+K+GDA +V M P KPM VE+F+DYPPLG  +  DMRQTVAVGVIK+V KK+ TG
Sbjct:  301 KNVSVKDIRRGYVASNAKNDPAKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFATIQTKIDRRSGKELEAEPKFIKSGDAAIVLMKPQKPMCVESFTDYPPLG-VSCGDMRQTVAVGVIKSVNKKENTG 435          
The following BLAST results are available for this feature:
BLAST of DC900196 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 171
Match NameE-valueIdentityDescription
EF1A_DANRE3.290e-4569.23Elongation factor 1-alpha OS=Danio rerio GN=eef1a ... [more]
EF1A_PODCU5.611e-4566.67Elongation factor 1-alpha OS=Podospora curvicolla ... [more]
EF1A2_SCHPO5.611e-4566.42Elongation factor 1-alpha-B/C OS=Schizosaccharomyc... [more]
EF1A1_SCHPO5.611e-4566.42Elongation factor 1-alpha-A OS=Schizosaccharomyces... [more]
EF1A3_HUMAN7.328e-4570.00Putative elongation factor 1-alpha-like 3 OS=Homo ... [more]
EF1A1_HORSE9.571e-4570.00Elongation factor 1-alpha 1 OS=Equus caballus GN=E... [more]
EF1A_CRYNE1.250e-4463.24Elongation factor 1-alpha OS=Cryptococcus neoforma... [more]
EF1A_ARXAD1.250e-4465.65Elongation factor 1-alpha OS=Arxula adeninivorans ... [more]
EF1A_STYLE2.785e-4468.07Elongation factor 1-alpha OS=Stylonychia lemnae GN... [more]
EF1A_EUGGR2.785e-4467.65Elongation factor 1-alpha OS=Euglena gracilis GN=T... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900196 VSS Citrus sinensis cDNA clone VS28233 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900196 ID=DC900196|Name=DC900196|organism=Citrus sinensis|type=EST|length=730bp
CAATGTGGCTCAACGTAAGAACGTGCTGCAAGGATCCCAGCGTGGTTTGT
GCTNCCAACCGAAGGATGATCCGGCCAGGNAAGCTGCCAACTTCACCTCA
CAGGTCATCATCATGAACCACCCTGGCCAGATTGGAAATGGATATGCCCC
AGTGCTTGACTGCCACACCTCCCACATTGCCGTCAAGTTTTCTGAGCTCG
TGACGAAGATTGATAGGCGATCAGGCAAGGAGCTTGAGAAGGAGCCCAAG
TTCTTGAAGAATGGAGATGCTGGAATGGTTAAGATGATTCCCACCAAGCC
CATGGTTGTTGAAACCTTCTCTGACTACCCACCTCTTGGTCGTTTTGCCG
TTAGGGACATGCGTCAGACTGTTGCTGTTGGTGTGATTAAGAATGTTGAA
AAGAAGGATCCAACAGGTGCCAAGGTCACCAAGTCTGCAGCCAAGAAGAA
GTGAATCGGGTTGGTTAATGTTGCTTTATCCGCAGATGGAGTCTATTTTA
ATAATTGTAGTTATACAAACTTGGTTATTTTTGGTACTGTTATAGTTCGA
TGCATGCTTTCCTTTTTAGGTTTTAGTTTGTTGCCTTTGGTGTCGGGTAN
NGATTCCCAGAATTGGGTGCTTGACAGGCGGTGGCGCAGCTCTAACCTGG
AGTCTCAATTTTATTAATAGTTATGGTCTTTGTTTGTATTGATACTTGAG
GTGGTTCGGTTTCATCTGAATCGGCTCAGA
back to top