DC900195

Overview
NameDC900195
Unique NameDC900195
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length770
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2169 contig Csv1_Contig2169:218..987. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A2_DAUCA (Elongation factor 1-alpha OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 469.159 bits (1206), Expect = 1.136e-131
Identity = 225/238 (94.54%), Postives = 235/238 (98.74%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK+R++EIVKEVSSYLKKVGYNP+K+ F+PISGFEGDNMI+RSTNLDWYKGPTLL+ALD I+EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM VTFGPSGLTTEV
Sbjct:   40 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRFEEIVKEVSSYLKKVGYNPDKIAFIPISGFEGDNMIDRSTNLDWYKGPTLLEALDQISEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEV 277          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A2_HORVU (Elongation factor 1-alpha OS=Hordeum vulgare GN=BLT63 PE=1 SV=1)

HSP 1 Score: 467.233 bits (1201), Expect = 4.315e-131
Identity = 226/238 (94.96%), Postives = 233/238 (97.90%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E FEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKY CTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVK MICCCNKMDATTPKYSK+RYDEIVKEVSSYLKKVGYNP+KVPFVPISGFEGDNMIERS+NLDWYKGPTLL+ALD INEPKRPS+KPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM VTFGP+GLTTEV
Sbjct:   40 ESFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYSCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKHMICCCNKMDATTPKYSKSRYDEIVKEVSSYLKKVGYNPDKVPFVPISGFEGDNMIERSSNLDWYKGPTLLEALDQINEPKRPSEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEV 277          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A1_HORVU (Elongation factor 1-alpha OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 466.463 bits (1199), Expect = 7.360e-131
Identity = 226/238 (94.96%), Postives = 233/238 (97.90%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKY CTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTG F+AGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK+RYDEIVKEVSSYLKKVGYNP+KVPFVPISGFEGDNMIERS+NLDWYKGPTLL+ALD INEPKRPSDKPL LPLQDVYKIGGIGTVPVGRVETGV+KPGM VTFGP+GLTTEV
Sbjct:   40 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYSCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGVFQAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRYDEIVKEVSSYLKKVGYNPDKVPFVPISGFEGDNMIERSSNLDWYKGPTLLEALDQINEPKRPSDKPLHLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEV 277          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_PEA (Elongation factor 1-alpha OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 461.84 bits (1187), Expect = 1.813e-129
Identity = 224/238 (94.12%), Postives = 232/238 (97.48%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            ERFEKEA EMNKRSFKYAW+LDKLKAERERGITIDIAL KFETTKYY TV+DAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK RY+EIVKEVSSYLK+VGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM VTF P+GLTTEV
Sbjct:   40 ERFEKEADEMNKRSFKYAWLLDKLKAERERGITIDIALLKFETTKYYSTVMDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYEEIVKEVSSYLKEVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVVKPGMLVTFAPTGLTTEV 277          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_DICDI (Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a1 PE=1 SV=2)

HSP 1 Score: 400.979 bits (1029), Expect = 3.798e-111
Identity = 191/238 (80.25%), Postives = 217/238 (91.18%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E++EKEA+EM K+SFKYAWV+DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVL+I S TG FEAGI+K+GQTREHALLA+TLGVKQMI   NKMD  +  YS+ARYDEIVKEVSS++KK+GYNPEKV FVPISG+ GDNM+ERS  ++WYKGPTLL+ALD I EPKRP DKPLR+PLQDVYKIGGIGTVPVGRVETG++KPGM VTF P+GL+TEV
Sbjct:   40 EKYEKEASEMGKQSFKYAWVMDKLKAERERGITIDIALWKFETSKYYFTIIDAPGHRDFIKNMITGTSQADCAVLVIASPTGEFEAGIAKNGQTREHALLAYTLGVKQMIVAINKMDEKSTNYSQARYDEIVKEVSSFIKKIGYNPEKVAFVPISGWNGDNMLERSDKMEWYKGPTLLEALDAIVEPKRPHDKPLRIPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFAPAGLSTEV 277          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_EUGGR (Elongation factor 1-alpha OS=Euglena gracilis GN=TEF PE=2 SV=1)

HSP 1 Score: 395.201 bits (1014), Expect = 2.084e-109
Identity = 196/238 (82.35%), Postives = 209/238 (87.82%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA+EM K SFKYAWVLDKLKAERER ITIDIALWKFET K   T+IDAPGHRDFIKNMITGTSQAD AVL+IDSTTGGFEAGISKDGQTREHALLA+TLGVKQMI   NK D  T KYS+ARY+EI KEVS YLKKVGYNPEKVPF+PISG+ GDNMIE S N+ WYKG TL+ ALDN+  PKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPG  VTF P+ LTTEV
Sbjct:   40 EKFEKEASEMGKGSFKYAWVLDKLKAERERCITIDIALWKFETAKSVFTIIDAPGHRDFIKNMITGTSQADAAVLVIDSTTGGFEAGISKDGQTREHALLAYTLGVKQMIVATNKFDDKTVKYSQARYEEIKKEVSGYLKKVGYNPEKVPFIPISGWNGDNMIEASENMGWYKGLTLIGALDNLEPPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGDVVTFAPNNLTTEV 277          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_TRYBB (Elongation factor 1-alpha OS=Trypanosoma brucei brucei GN=TEF1 PE=1 SV=3)

HSP 1 Score: 384.415 bits (986), Expect = 3.678e-106
Identity = 188/238 (78.99%), Postives = 207/238 (86.97%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAA++ K SFKYAWVLDKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD A+LII S  G FEAGISKDGQTREHALLAFTLGVKQM+ CCNKMD  T  Y + RYDEIVKEVS+Y+KKVGYN EKV FVPISG++GDNMIE+S  + WYKGPTLL+ALD +  P RPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPG  VTF P+ +TTEV
Sbjct:   40 EKFEKEAADIGKASFKYAWVLDKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAILIIASAQGEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVNYGQERYDEIVKEVSAYIKKVGYNVEKVRFVPISGWQGDNMIEKSEKMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVMKPGDVVTFAPANVTTEV 277          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_PODCU (Elongation factor 1-alpha OS=Podospora curvicolla GN=TEF PE=3 SV=1)

HSP 1 Score: 380.178 bits (975), Expect = 6.937e-105
Identity = 189/250 (75.60%), Postives = 212/250 (84.80%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + TG FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD T  K+S+AR++EI+KE S+++KKVGYNP+ V FVPISGF GDNM+E STN  WYK            G TLL+A+D+I  PKRP+DKPLRLPLQDVYKIGGIGTVPVGR+ETG+LKPGM VTF PS +TTEV
Sbjct:   41 EKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEARFNEIIKETSNFIKKVGYNPKTVAFVPISGFNGDNMLEASTNCPWYKGWEKEVKGGKATGKTLLEAIDSIEPPKRPTDKPLRLPLQDVYKIGGIGTVPVGRIETGILKPGMVVTFAPSNVTTEV 288          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_PODAN (Elongation factor 1-alpha OS=Podospora anserina GN=TEF PE=3 SV=1)

HSP 1 Score: 380.178 bits (975), Expect = 6.937e-105
Identity = 189/250 (75.60%), Postives = 212/250 (84.80%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + TG FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD T  K+S+AR++EI+KE S+++KKVGYNP+ V FVPISGF GDNM+E STN  WYK            G TLL+A+D+I  PKRP+DKPLRLPLQDVYKIGGIGTVPVGR+ETG+LKPGM VTF PS +TTEV
Sbjct:   41 EKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEARFNEIIKETSNFIKKVGYNPKTVAFVPISGFNGDNMLEASTNCPWYKGWEKEVKGGKATGKTLLEAIDSIEPPKRPTDKPLRLPLQDVYKIGGIGTVPVGRIETGILKPGMVVTFAPSNVTTEV 288          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_DANRE (Elongation factor 1-alpha OS=Danio rerio GN=eef1a PE=2 SV=1)

HSP 1 Score: 380.178 bits (975), Expect = 6.937e-105
Identity = 189/250 (75.60%), Postives = 210/250 (84.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+    G FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS+AR++EI KEVS+Y+KK+GYNP  V FVPISG+ GDNM+E S+N+ W+K            G TLLDALD I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM VTF P+ +TTEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAGGVGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEITKEVSAYIKKIGYNPASVAFVPISGWHGDNMLEASSNMGWFKGWKIERKEGNASGTTLLDALDAILPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPANVTTEV 289          
The following BLAST results are available for this feature:
BLAST of DC900195 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A2_DAUCA1.136e-13194.54Elongation factor 1-alpha OS=Daucus carota PE=2 SV... [more]
EF1A2_HORVU4.315e-13194.96Elongation factor 1-alpha OS=Hordeum vulgare GN=BL... [more]
EF1A1_HORVU7.360e-13194.96Elongation factor 1-alpha OS=Hordeum vulgare PE=1 ... [more]
EF1A_PEA1.813e-12994.12Elongation factor 1-alpha OS=Pisum sativum PE=2 SV... [more]
EF1A_DICDI3.798e-11180.25Elongation factor 1-alpha OS=Dictyostelium discoid... [more]
EF1A_EUGGR2.084e-10982.35Elongation factor 1-alpha OS=Euglena gracilis GN=T... [more]
EF1A_TRYBB3.678e-10678.99Elongation factor 1-alpha OS=Trypanosoma brucei br... [more]
EF1A_PODCU6.937e-10575.60Elongation factor 1-alpha OS=Podospora curvicolla ... [more]
EF1A_PODAN6.937e-10575.60Elongation factor 1-alpha OS=Podospora anserina GN... [more]
EF1A_DANRE6.937e-10575.60Elongation factor 1-alpha OS=Danio rerio GN=eef1a ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900195 VSS Citrus sinensis cDNA clone VS28233 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900195 ID=DC900195|Name=DC900195|organism=Citrus sinensis|type=EST|length=770bp
GAGAGGTTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCATCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTTGACTGGTACAAGGGTCCAACCCTGCTGGACGCTCTTGACAATA
TCAATGAGCCAAAGAGGCCCTCAGACAAGCCCCTTCGTCTGCCACTCCAG
GACGTGTACAAGATTGGTGGCATTGGAACCGTCCCAGTGGGTCGCGTTGA
GACCGGTGTCCTCAAGCCTGGTATGGNGGTGACATTTGGCCCCTCTGGAT
TGACAACTGAGGTAAGTCTGTTGAGATGCACCACGAGCTNTGCAGGAGGC
CTTCCGGTGACATGTTGGCT
back to top