DC900195

Overview
NameDC900195
Unique NameDC900195
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length770
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2169 contig Csv1_Contig2169:218..987. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_CAEEL (Elongation factor 1-alpha OS=Caenorhabditis elegans GN=eft-3 PE=2 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 1.308e-103
Identity = 183/250 (73.20%), Postives = 209/250 (83.60%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVL++   TG FEAGISK+GQTREHALLA TLGVKQ+I  CNKMD+T P +S+AR+ EI  EVS ++KK+GYNP+ VPFVPISGF GDNM+E S+N+ W+K            G TLL+ALD+I  P+RP+D+PLRLPLQDVYKIGGIGTVPVGRVETG++KPGM VTF P  +TTEV
Sbjct:   40 EKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSNMPWFKGWAVERKEGNASGKTLLEALDSIIPPQRPTDRPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFAPQNVTTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A3_HUMAN (Putative elongation factor 1-alpha-like 3 OS=Homo sapiens GN=EEF1AL3 PE=5 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 1.308e-103
Identity = 187/250 (74.80%), Postives = 210/250 (84.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVPISG+ GDNM+E S N+ W+K            G TLL+ALD I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM VTF P  +TTEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A1_RAT (Elongation factor 1-alpha 1 OS=Rattus norvegicus GN=Eef1a1 PE=2 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 1.308e-103
Identity = 187/250 (74.80%), Postives = 210/250 (84.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVPISG+ GDNM+E S N+ W+K            G TLL+ALD I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM VTF P  +TTEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGSASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A1_RABIT (Elongation factor 1-alpha 1 OS=Oryctolagus cuniculus GN=EEF1A1 PE=1 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 1.308e-103
Identity = 187/250 (74.80%), Postives = 210/250 (84.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVPISG+ GDNM+E S N+ W+K            G TLL+ALD I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM VTF P  +TTEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A1_PONAB (Elongation factor 1-alpha 1 OS=Pongo abelii GN=EEF1A1 PE=2 SV=2)

HSP 1 Score: 375.941 bits (964), Expect = 1.308e-103
Identity = 187/250 (74.80%), Postives = 210/250 (84.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVPISG+ GDNM+E S N+ W+K            G TLL+ALD I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM VTF P  +TTEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A1_PANTR (Elongation factor 1-alpha 1 OS=Pan troglodytes GN=EEF1A1 PE=2 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 1.308e-103
Identity = 187/250 (74.80%), Postives = 210/250 (84.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVPISG+ GDNM+E S N+ W+K            G TLL+ALD I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM VTF P  +TTEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A1_MOUSE (Elongation factor 1-alpha 1 OS=Mus musculus GN=Eef1a1 PE=1 SV=3)

HSP 1 Score: 375.941 bits (964), Expect = 1.308e-103
Identity = 187/250 (74.80%), Postives = 210/250 (84.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVPISG+ GDNM+E S N+ W+K            G TLL+ALD I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM VTF P  +TTEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGSASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A1_HUMAN (Elongation factor 1-alpha 1 OS=Homo sapiens GN=EEF1A1 PE=1 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 1.308e-103
Identity = 187/250 (74.80%), Postives = 210/250 (84.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVPISG+ GDNM+E S N+ W+K            G TLL+ALD I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM VTF P  +TTEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A1_HORSE (Elongation factor 1-alpha 1 OS=Equus caballus GN=EEF1A1 PE=2 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 1.308e-103
Identity = 187/250 (74.80%), Postives = 210/250 (84.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVPISG+ GDNM+E S N+ W+K            G TLL+ALD I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM VTF P  +TTEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A1_FELCA (Elongation factor 1-alpha 1 OS=Felis catus GN=EEF1A1 PE=2 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 1.308e-103
Identity = 187/250 (74.80%), Postives = 210/250 (84.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVPISG+ GDNM+E S N+ W+K            G TLL+ALD I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM VTF P  +TTEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEV 289          
The following BLAST results are available for this feature:
BLAST of DC900195 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_CAEEL1.308e-10373.20Elongation factor 1-alpha OS=Caenorhabditis elegan... [more]
EF1A3_HUMAN1.308e-10374.80Putative elongation factor 1-alpha-like 3 OS=Homo ... [more]
EF1A1_RAT1.308e-10374.80Elongation factor 1-alpha 1 OS=Rattus norvegicus G... [more]
EF1A1_RABIT1.308e-10374.80Elongation factor 1-alpha 1 OS=Oryctolagus cunicul... [more]
EF1A1_PONAB1.308e-10374.80Elongation factor 1-alpha 1 OS=Pongo abelii GN=EEF... [more]
EF1A1_PANTR1.308e-10374.80Elongation factor 1-alpha 1 OS=Pan troglodytes GN=... [more]
EF1A1_MOUSE1.308e-10374.80Elongation factor 1-alpha 1 OS=Mus musculus GN=Eef... [more]
EF1A1_HUMAN1.308e-10374.80Elongation factor 1-alpha 1 OS=Homo sapiens GN=EEF... [more]
EF1A1_HORSE1.308e-10374.80Elongation factor 1-alpha 1 OS=Equus caballus GN=E... [more]
EF1A1_FELCA1.308e-10374.80Elongation factor 1-alpha 1 OS=Felis catus GN=EEF1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900195 VSS Citrus sinensis cDNA clone VS28233 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900195 ID=DC900195|Name=DC900195|organism=Citrus sinensis|type=EST|length=770bp
GAGAGGTTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCATCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTTGACTGGTACAAGGGTCCAACCCTGCTGGACGCTCTTGACAATA
TCAATGAGCCAAAGAGGCCCTCAGACAAGCCCCTTCGTCTGCCACTCCAG
GACGTGTACAAGATTGGTGGCATTGGAACCGTCCCAGTGGGTCGCGTTGA
GACCGGTGTCCTCAAGCCTGGTATGGNGGTGACATTTGGCCCCTCTGGAT
TGACAACTGAGGTAAGTCTGTTGAGATGCACCACGAGCTNTGCAGGAGGC
CTTCCGGTGACATGTTGGCT
back to top