DC900195

Overview
NameDC900195
Unique NameDC900195
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length770
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2169 contig Csv1_Contig2169:218..987. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A2_SCHPO (Elongation factor 1-alpha-B/C OS=Schizosaccharomyces pombe GN=tef1b PE=1 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 2.915e-103
Identity = 191/265 (72.08%), Postives = 217/265 (81.89%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWY------------KGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV-SLLRCTTSXAGGLP 756
            E+FEKEA E+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII   TG FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD T   +S+AR++EIVKE S+++KKVG+NP+ VPFVP+SGF+GDNMIE +TN+ WY            KG TLL+A+D+I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM VTF P+G+TTEV S+     S   GLP
Sbjct:   40 EKFEKEATELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAILIIGGGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAVNKMDTT--GWSQARFEEIVKETSNFIKKVGFNPKTVPFVPVSGFQGDNMIEPTTNMPWYQGWQKETKAGVVKGKTLLEAIDSIEPPARPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMIVTFAPAGVTTEVKSVEMHHESLDAGLP 302          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_AJECG (Elongation factor 1-alpha OS=Ajellomyces capsulata (strain ATCC 26029 / G186AR / H82 / RMSCC 2432) GN=TEF PE=2 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 3.807e-103
Identity = 188/250 (75.20%), Postives = 210/250 (84.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA E+ K+SFKYAWVLDKLK+ERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII + TG FEAGISKDGQTREHALLAFTLGV+Q+I   NKMD T  K+S++R++EI+KEVS+++KKVGYNP+ VPFVPISGFEGDNMIE S N  WYK            G TLLDA+D I  P RP+DKPLRLPLQDVYKI GIGTVPVGRVETGV+KPGM VTF PS +TTEV
Sbjct:   41 EKFEKEAEELGKKSFKYAWVLDKLKSERERGITIDIALWKFETPKYSVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGTGEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMDTT--KWSESRFNEIIKEVSNFIKKVGYNPKAVPFVPISGFEGDNMIEPSPNCTWYKGWNKETASGKSSGKTLLDAIDAIEPPTRPTDKPLRLPLQDVYKISGIGTVPVGRVETGVIKPGMVVTFAPSNVTTEV 288          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_TRIRE (Elongation factor 1-alpha OS=Trichoderma reesei GN=tef1 PE=3 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 4.971e-103
Identity = 187/250 (74.80%), Postives = 209/250 (83.60%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + TG FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD  T  +++ARY EI+KE S+++KKVG+NP+ V FVPISGF GDNM+  STN  WYK            G TLL+A+D+I  PKRP+DKPLRLPLQDVYKIGGIGTVPVGR+ETGVLKPGM VTF PS +TTEV
Sbjct:   41 EKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMD--TANWAEARYQEIIKETSNFIKKVGFNPKAVAFVPISGFNGDNMLTPSTNCPWYKGWEKETKAGKFTGKTLLEAIDSIEPPKRPTDKPLRLPLQDVYKIGGIGTVPVGRIETGVLKPGMVVTFAPSNVTTEV 288          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_NEUCR (Elongation factor 1-alpha OS=Neurospora crassa GN=tef-1 PE=3 SV=2)

HSP 1 Score: 373.629 bits (958), Expect = 6.493e-103
Identity = 187/250 (74.80%), Postives = 208/250 (83.20%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + TG FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD T  ++S+ R++EI+KE  +++KKVGYNP  V FVPISGF GDNM+E STN  WYK            G TLL+A+D I  PKRP+DKPLRLPLQDVYKIGGIGTVPVGR+ETGVLKPGM VTF PS +TTEV
Sbjct:   41 EKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--QWSQTRFEEIIKETKNFIKKVGYNPAGVAFVPISGFNGDNMLEPSTNCPWYKGWEKETKAGKATGKTLLEAIDAIEPPKRPTDKPLRLPLQDVYKIGGIGTVPVGRIETGVLKPGMVVTFAPSNVTTEV 288          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_ABSGL (Elongation factor 1-alpha OS=Absidia glauca GN=TEF-1 PE=3 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 6.493e-103
Identity = 185/250 (74.00%), Postives = 212/250 (84.80%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY+ TVIDAPGHRDFIKNMITGTSQADC +LII + TG FEAGISKDGQTREHALLAFTLGV+Q+I   NKMD+T  K+S+ R++EI+KEVS ++KK+G+NP+ VPFVPISG+ GDNM+E STN+ WYK            G TLLDA+D I+ P+RPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+K GM VTF P+ +TTEV
Sbjct:   40 EKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMITGTSQADCGILIIAAGTGEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMDST--KWSEQRFNEIIKEVSGFIKKIGFNPKSVPFVPISGWHGDNMLEESTNMPWYKGWNKETKAGAKSGKTLLDAIDAIDPPQRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKAGMVVTFAPANVTTEV 287          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A2_XENLA (Elongation factor 1-alpha, oocyte form OS=Xenopus laevis GN=eef1ao PE=1 SV=1)

HSP 1 Score: 373.244 bits (957), Expect = 8.480e-103
Identity = 186/250 (74.40%), Postives = 209/250 (83.60%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFET K+Y T+IDAPGHRDFIKNMITGTSQADCAVLI+    G FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P +S+ R++EI KEVS+Y+KK+GYNP  VPFVPISG+ GDNM+E STN+ W+K            G TLL+ALD I  P+RP+ KPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM VTF PS +TTEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETGKFYITIIDAPGHRDFIKNMITGTSQADCAVLIVAGGVGEFEAGISKNGQTREHALLAFTLGVKQLIIGVNKMDSTEPPFSQKRFEEITKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEASTNMPWFKGWKIERKEGNASGVTLLEALDCIIPPQRPTAKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMIVTFAPSNVTTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A1_DROME (Elongation factor 1-alpha 1 OS=Drosophila melanogaster GN=Ef1alpha48D PE=1 SV=2)

HSP 1 Score: 373.244 bits (957), Expect = 8.480e-103
Identity = 187/250 (74.80%), Postives = 207/250 (82.80%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD++ P YS+ARY+EI KEVSSY+KK+GYNP  V FVPISG+ GDNM+E STN+ W+K            G TL+DALD I  P RP+DK LRLPLQDVYKIGGIGTVPVGRVETGVLKPG  V F P+ +TTEV
Sbjct:   40 EKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEGNADGKTLIDALDAILPPARPTDKALRLPLQDVYKIGGIGTVPVGRVETGVLKPGTVVVFAPANITTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A1_OSCTI (Elongation factor 1-alpha 1 OS=Oscheius tipulae GN=eft-1 PE=3 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 1.108e-102
Identity = 182/250 (72.80%), Postives = 206/250 (82.40%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET K+Y T+IDAPGHRDFIK MITGTSQADCAVL++   TG FEAGISK+GQTREHALLA TLGVKQMI  CNKMD+T P +S+ R++EI+ EV S++KK+GYNP  +PFVPISGF GDNM+E S N+ WYK            G TLL+ALD I  P+RP+D+PLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM VTF P  +TTEV
Sbjct:   40 EKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKFYVTIIDAPGHRDFIKKMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQMIVACNKMDSTEPPFSEKRFEEIITEVKSFIKKIGYNPATIPFVPISGFNGDNMLEPSANMSWYKGWSVERKEGNASGKTLLEALDCIIPPQRPTDRPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPQNVTTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_AURPU (Elongation factor 1-alpha OS=Aureobasidium pullulans GN=TEF1 PE=3 SV=1)

HSP 1 Score: 372.089 bits (954), Expect = 1.889e-102
Identity = 187/249 (75.10%), Postives = 208/249 (83.53%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK-----------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAE+ K SFKYAWVLDKLK+ERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII + TG FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD T  K+S+ARY EI+KE S ++KKVGYNP+ VPFVPISGF GDNMIE S+N  WYK           G TLL+A+D I+ P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETG +K GM VTF P+G+TTEV
Sbjct:   40 EKFEKEAAELGKGSFKYAWVLDKLKSERERGITIDIALWKFETPKYMVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEARYQEIIKETSGFIKKVGYNPKHVPFVPISGFNGDNMIEVSSNCPWYKGWEKETKAKATGKTLLEAIDAIDPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGTIKGGMVVTFAPAGVTTEV 286          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_ASPOR (Elongation factor 1-alpha OS=Aspergillus oryzae GN=tef1 PE=3 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 2.467e-102
Identity = 188/250 (75.20%), Postives = 209/250 (83.60%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAE+ K SFKYAWVLDKLK+ERERGITIDIALWKF+T+KY  TVIDAPGHRDFIKNMITGTSQADCA+LII S TG FEAGISKDGQTREHALLAFTLGV+Q+I   NKMD  T K+S+ RY+EIVKE S+++KKVGYNP+ VPFVPISGF GDNMIE STN  WYK            G TLL+A+D I  P RP+DKPLRLPLQDVYKI GIGTVPVGRVETGV+KPGM VTF P+ +TTEV
Sbjct:   41 EKFEKEAAELGKGSFKYAWVLDKLKSERERGITIDIALWKFQTSKYEVTVIDAPGHRDFIKNMITGTSQADCAILIIASGTGEFEAGISKDGQTREHALLAFTLGVRQLIVALNKMD--TCKWSQDRYNEIVKETSNFIKKVGYNPKSVPFVPISGFNGDNMIEASTNCPWYKGWEKETKAGKSTGKTLLEAIDAIEPPVRPTDKPLRLPLQDVYKISGIGTVPVGRVETGVIKPGMVVTFAPANVTTEV 288          
The following BLAST results are available for this feature:
BLAST of DC900195 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A2_SCHPO2.915e-10372.08Elongation factor 1-alpha-B/C OS=Schizosaccharomyc... [more]
EF1A_AJECG3.807e-10375.20Elongation factor 1-alpha OS=Ajellomyces capsulata... [more]
EF1A_TRIRE4.971e-10374.80Elongation factor 1-alpha OS=Trichoderma reesei GN... [more]
EF1A_NEUCR6.493e-10374.80Elongation factor 1-alpha OS=Neurospora crassa GN=... [more]
EF1A_ABSGL6.493e-10374.00Elongation factor 1-alpha OS=Absidia glauca GN=TEF... [more]
EF1A2_XENLA8.480e-10374.40Elongation factor 1-alpha, oocyte form OS=Xenopus ... [more]
EF1A1_DROME8.480e-10374.80Elongation factor 1-alpha 1 OS=Drosophila melanoga... [more]
EF1A1_OSCTI1.108e-10272.80Elongation factor 1-alpha 1 OS=Oscheius tipulae GN... [more]
EF1A_AURPU1.889e-10275.10Elongation factor 1-alpha OS=Aureobasidium pullula... [more]
EF1A_ASPOR2.467e-10275.20Elongation factor 1-alpha OS=Aspergillus oryzae GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900195 VSS Citrus sinensis cDNA clone VS28233 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900195 ID=DC900195|Name=DC900195|organism=Citrus sinensis|type=EST|length=770bp
GAGAGGTTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCATCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTTGACTGGTACAAGGGTCCAACCCTGCTGGACGCTCTTGACAATA
TCAATGAGCCAAAGAGGCCCTCAGACAAGCCCCTTCGTCTGCCACTCCAG
GACGTGTACAAGATTGGTGGCATTGGAACCGTCCCAGTGGGTCGCGTTGA
GACCGGTGTCCTCAAGCCTGGTATGGNGGTGACATTTGGCCCCTCTGGAT
TGACAACTGAGGTAAGTCTGTTGAGATGCACCACGAGCTNTGCAGGAGGC
CTTCCGGTGACATGTTGGCT
back to top