DC900195

Overview
NameDC900195
Unique NameDC900195
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length770
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2169 contig Csv1_Contig2169:218..987. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_ARTSA (Elongation factor 1-alpha OS=Artemia salina PE=1 SV=2)

HSP 1 Score: 371.318 bits (952), Expect = 3.222e-102
Identity = 184/250 (73.60%), Postives = 207/250 (82.80%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P +S+AR++EI KEVS+Y+KK+GYNP  V FVPISG+ GDNM+E S  L WYK            G TLLDALD I  P RP++KPLRLPLQDVYKIGGIGTVPVGRVETG++KPGM VTF P+ +TTEV
Sbjct:   40 EKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPFSEARFEEIKKEVSAYIKKIGYNPAAVAFVPISGWHGDNMLEASDRLPWYKGWNIERKEGKADGKTLLDALDAILPPSRPTEKPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMIVTFAPANITTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A2_DROME (Elongation factor 1-alpha 2 OS=Drosophila melanogaster GN=Ef1alpha100E PE=1 SV=2)

HSP 1 Score: 371.318 bits (952), Expect = 3.222e-102
Identity = 186/250 (74.40%), Postives = 206/250 (82.40%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS+ARY+EI KEVSSY+KK+GYNP  V FVPISG+ GDNM+E S  + W+K            G  L+DALD I  P+RP+DKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGM V F P  L TEV
Sbjct:   40 EKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPISGWHGDNMLEPSEKMPWFKGWSVERKEGKAEGKCLIDALDAILPPQRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGLLKPGMVVNFAPVNLVTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_ENTHI (Elongation factor 1-alpha OS=Entamoeba histolytica PE=2 SV=1)

HSP 1 Score: 370.933 bits (951), Expect = 4.209e-102
Identity = 178/237 (75.11%), Postives = 207/237 (87.34%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTE 711
            E+FEKE+AEM K SFKYAWVLD LKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQAD A+LI+ + TG FEAGISK+GQTREH LL++TLGVKQMI   NKMDA   +Y + RY+EI KE+S++LKK GYNP+K+PFVPISGF+GDNMIE STN+ WYKGPTL+ ALD++  P+RP DKPLRLPLQDVYKI GIGTVPVGRVETG+LKPG  V F PSG+++E
Sbjct:   40 EKFEKESAEMGKGSFKYAWVLDNLKAERERGITIDISLWKFETSKYYFTIIDAPGHRDFIKNMITGTSQADVAILIVAAGTGEFEAGISKNGQTREHILLSYTLGVKQMIVGVNKMDAI--QYKQERYEEIKKEISAFLKKTGYNPDKIPFVPISGFQGDNMIEPSTNMPWYKGPTLIGALDSVTPPERPVDKPLRLPLQDVYKISGIGTVPVGRVETGILKPGTIVQFAPSGVSSE 274          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_ARXAD (Elongation factor 1-alpha OS=Arxula adeninivorans GN=TEF PE=3 SV=1)

HSP 1 Score: 370.933 bits (951), Expect = 4.209e-102
Identity = 186/250 (74.40%), Postives = 209/250 (83.60%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAE+ K SFKYAWVLDKLKAERER ITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII   TG FEAGISKDGQTREHALLAFTLGV+Q+I   NKMD+    +S+ RY+EIVKE S+++KKVG+NP+ VPFVPISG+ GDNMIE +TN  WYK            G TLL+A+D ++ P RPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM VTF P+G+TTEV
Sbjct:   40 EKFEKEAAELGKGSFKYAWVLDKLKAERERVITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGTGEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMDSV--NWSEDRYNEIVKETSNFIKKVGFNPKAVPFVPISGWNGDNMIEATTNASWYKGWHKETKEGKATGKTLLEAIDAVDPPTRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEV 287          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_YEAST (Elongation factor 1-alpha OS=Saccharomyces cerevisiae GN=TEF1 PE=1 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 5.497e-102
Identity = 185/250 (74.00%), Postives = 208/250 (83.20%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWY------------KGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII    G FEAGISKDGQTREHALLAFTLGV+Q+I   NKMD+   K+ ++R+ EIVKE S+++KKVGYNP+ VPFVPISG+ GDNMIE +TN  WY            KG TLL+A+D I +P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM VTF P+G+TTEV
Sbjct:   40 EKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSV--KWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEV 287          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_PICGU (Elongation factor 1-alpha OS=Pichia guilliermondii GN=TEF1 PE=3 SV=2)

HSP 1 Score: 369.777 bits (948), Expect = 9.376e-102
Identity = 184/250 (73.60%), Postives = 209/250 (83.60%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY+ TVIDAPGHRDFIKNMITGTSQADCA+LII   TG FEAGISKDGQTREHALLA+TLGV+Q+I   NKMD+   K+ K R++EI+KE S+++KKVGYNP+ VPFVPISG+ GDNMIE STN  WYK            G TLL+A+D I  P+RP+DKPLRLPLQDVYKIGGIGTVPVGRVETG++K GM VTF P+G+TTEV
Sbjct:   40 EKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGTGEFEAGISKDGQTREHALLAYTLGVRQLIVAVNKMDSV--KWDKNRFEEIIKETSNFVKKVGYNPKTVPFVPISGWNGDNMIEASTNCPWYKGWEKETKAGKSTGKTLLEAIDAIEPPQRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKAGMVVTFAPAGVTTEV 287          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_CANAL (Elongation factor 1-alpha OS=Candida albicans GN=TEF1 PE=1 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 9.376e-102
Identity = 185/250 (74.00%), Postives = 208/250 (83.20%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY+ TVIDAPGHRDFIKNMITGTSQADCA+LII   TG FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD+   K+ K R++EI+KE S+++KKVGYNP+ VPFVPISG+ GDNMIE STN  WYK            G TLL+A+D I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETG++K GM VTF P+G+TTEV
Sbjct:   40 EKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAVNKMDSV--KWDKNRFEEIIKETSNFVKKVGYNPKTVPFVPISGWNGDNMIEPSTNCPWYKGWEKETKSGKVTGKTLLEAIDAIEPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKAGMVVTFAPAGVTTEV 287          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_BOMMO (Elongation factor 1-alpha OS=Bombyx mori PE=2 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 1.225e-101
Identity = 184/250 (73.60%), Postives = 207/250 (82.80%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS+ R++EI KEVSSY+KK+GYNP  V FVPISG+ GDNM+E ST + W+K            G +L++ALD I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPG  V F P+ +TTEV
Sbjct:   40 EKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKSLIEALDAILPPARPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGTIVVFAPANITTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_ASHGO (Elongation factor 1-alpha OS=Ashbya gossypii GN=TEF PE=3 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 1.225e-101
Identity = 186/250 (74.40%), Postives = 207/250 (82.80%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWY------------KGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY+ TVIDAPGHRDFIKNMITGTSQADCA+LII    G FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD+   K+ ++RY EIVKE S+++KKVGYNP+ VPFVPISG+ GDNMIE +TN  WY            KG TLL+A+D I  P RP+DK LRLPLQDVYKIGGIGTVPVGRVETGV+KPGM VTF PSG+TTEV
Sbjct:   40 EKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDSV--KWDESRYQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGAVKGKTLLEAIDAIEPPVRPTDKALRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPSGVTTEV 287          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_SPOFR (Elongation factor 1-alpha (Fragment) OS=Spodoptera frugiperda PE=1 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 1.599e-101
Identity = 183/250 (73.20%), Postives = 206/250 (82.40%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GYNP  V FVPISG+ GDNM+E ST + W+K            G  L++ALD I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPG  V F P+ +TTEV
Sbjct:   26 EKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEASTKMPWFKGWNVERKEGKAEGKCLIEALDAILPPARPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGTIVVFAPANITTEV 275          
The following BLAST results are available for this feature:
BLAST of DC900195 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_ARTSA3.222e-10273.60Elongation factor 1-alpha OS=Artemia salina PE=1 S... [more]
EF1A2_DROME3.222e-10274.40Elongation factor 1-alpha 2 OS=Drosophila melanoga... [more]
EF1A_ENTHI4.209e-10275.11Elongation factor 1-alpha OS=Entamoeba histolytica... [more]
EF1A_ARXAD4.209e-10274.40Elongation factor 1-alpha OS=Arxula adeninivorans ... [more]
EF1A_YEAST5.497e-10274.00Elongation factor 1-alpha OS=Saccharomyces cerevis... [more]
EF1A_PICGU9.376e-10273.60Elongation factor 1-alpha OS=Pichia guilliermondii... [more]
EF1A_CANAL9.376e-10274.00Elongation factor 1-alpha OS=Candida albicans GN=T... [more]
EF1A_BOMMO1.225e-10173.60Elongation factor 1-alpha OS=Bombyx mori PE=2 SV=1[more]
EF1A_ASHGO1.225e-10174.40Elongation factor 1-alpha OS=Ashbya gossypii GN=TE... [more]
EF1A_SPOFR1.599e-10173.20Elongation factor 1-alpha (Fragment) OS=Spodoptera... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900195 VSS Citrus sinensis cDNA clone VS28233 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900195 ID=DC900195|Name=DC900195|organism=Citrus sinensis|type=EST|length=770bp
GAGAGGTTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCATCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTTGACTGGTACAAGGGTCCAACCCTGCTGGACGCTCTTGACAATA
TCAATGAGCCAAAGAGGCCCTCAGACAAGCCCCTTCGTCTGCCACTCCAG
GACGTGTACAAGATTGGTGGCATTGGAACCGTCCCAGTGGGTCGCGTTGA
GACCGGTGTCCTCAAGCCTGGTATGGNGGTGACATTTGGCCCCTCTGGAT
TGACAACTGAGGTAAGTCTGTTGAGATGCACCACGAGCTNTGCAGGAGGC
CTTCCGGTGACATGTTGGCT
back to top