DC900195

Overview
NameDC900195
Unique NameDC900195
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length770
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2169 contig Csv1_Contig2169:218..987. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_BLAHO (Elongation factor 1-alpha OS=Blastocystis hominis PE=2 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 1.267e-98
Identity = 177/240 (73.75%), Postives = 200/240 (83.33%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYN--PEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            ERFE+    + K SFKYAWVL K+KAERERGITIDI+LWKFET K + T+IDAPGHRDFIKNMITGTSQAD A+L+I S  G FEAG SK+GQTREHALLA TLGVKQMI CCNKMD  +  YS+ARY EI  E++S+L KVGY    E++PF+PISGF GDNMIE S N+ WYKGPTLL+ALDN++ PKRP DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM VTF P  ++TEV
Sbjct:   40 ERFEEGGQRIGKGSFKYAWVLAKMKAERERGITIDISLWKFETRKDFFTIIDAPGHRDFIKNMITGTSQADVAILVIASGAGEFEAGYSKNGQTREHALLANTLGVKQMIVCCNKMDDKSVNYSEARYKEIKNEMTSFLTKVGYAKVEERIPFIPISGFNGDNMIEHSANMPWYKGPTLLEALDNVHPPKRPVDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMTVTFAPVNVSTEV 279          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_CRYPV (Elongation factor 1-alpha OS=Cryptosporidium parvum PE=2 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 8.214e-98
Identity = 174/238 (73.11%), Postives = 202/238 (84.87%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKE++EM K SFKYAWVLDKLKAERERGITIDIALW+FET KY+ TVIDAPGHRDFIKNMITGTSQAD A+L++ +    FE   SK+GQTREHALLAFTLGV+QMI   NKMD  T +Y ++R+DEI  EV  YLKKVGYN EK+PFV ISGF GDNM+ERS  + WYKG TL++ALD +  PKRP+DKPLRLPLQDVYKIGG+GTVPVGRVETG+++PGM VTF P+G+TTEV
Sbjct:   40 EKFEKESSEMGKGSFKYAWVLDKLKAERERGITIDIALWQFETPKYHYTVIDAPGHRDFIKNMITGTSQADVALLVVPADR--FEGAFSKEGQTREHALLAFTLGVRQMIVGINKMD--TCEYKQSRFDEIFNEVDGYLKKVGYNTEKIPFVAISGFVGDNMVERSDKMPWYKGKTLVEALDTMEPPKRPTDKPLRLPLQDVYKIGGVGTVPVGRVETGIIRPGMNVTFAPAGVTTEV 273          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_STYLE (Elongation factor 1-alpha OS=Stylonychia lemnae GN=EFAA PE=3 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 5.324e-97
Identity = 172/237 (72.57%), Postives = 197/237 (83.12%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTE 711
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDIALW FET K   T+IDAPGHRDFIKNMITGTSQAD A+LII S  G FEAGISK+GQTREHALLAFT+GVKQMI   NKMD  +  + + R+ EI KE+S YLKK+   P + PF+PISG+ GDNM+E+S N+ W+ G TL+DALD +++PKRP DKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGM +TF P  +TTE
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWNFETAKSVFTIIDAPGHRDFIKNMITGTSQADAAILIIASGQGEFEAGISKEGQTREHALLAFTMGVKQMIVAVNKMDDKSVNWDQGRFIEIKKELSDYLKKIWLQPRQDPFIPISGWHGDNMLEKSPNMPWFTGSTLIDALDALDQPKRPKDKPLRLPLQDVYKIGGIGTVPVGRVETGLLKPGMVLTFAPMNITTE 276          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_PLAFK (Elongation factor 1-alpha OS=Plasmodium falciparum (isolate K1 / Thailand) GN=MEF-1 PE=3 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 2.921e-95
Identity = 168/237 (70.89%), Postives = 196/237 (82.70%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTE 711
            E+FEKE+AEM K SFKYAWVLDKLKAERERGITIDIALWKFET +Y+ TVIDAPGH+DFIKNMITGTSQAD A+L++ +  GGF+   SK+GQT+EH LLAFTLGVKQ++   NKMD  T KYS+ RY+EI KEV  YLKKVGY  +KV F+PISGFEGDN+IE+S    WYKG TL++ALD +  PKRP DKPLR+PLQ VYKIGGIGTVPVGRVETG+LK GM + F PS + +E
Sbjct:   40 EKFEKESAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETPRYFFTVIDAPGHKDFIKNMITGTSQADVALLVVPADVGGFDGAFSKEGQTKEHVLLAFTLGVKQIVVGVNKMD--TVKYSEDRYEEIKKEVKDYLKKVGYQADKVDFIPISGFEGDNLIEKSDKTPWYKGRTLIEALDTMQPPKRPYDKPLRIPLQGVYKIGGIGTVPVGRVETGILKAGMVLNFAPSAVVSE 274          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_RHYAM (Elongation factor 1-alpha (Fragment) OS=Rhynchosciara americana PE=2 SV=1)

HSP 1 Score: 335.88 bits (860), Expect = 1.500e-91
Identity = 169/237 (71.31%), Postives = 191/237 (80.59%), Query Frame = 1
Query:   40 SFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTL------------LDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P +S+ RY+EI KEVSSY+KK+GYNP  V FVPISG+ GDNM+E S+N+ W KG  +              ALD I  P RP+D+ LRLPL DVYKIGGIGTVPVGR+ETG+LKPG  V F P+ +TTEV
Sbjct:    2 SFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPFSENRYEEIKKEVSSYIKKIGYNPVAVAFVPISGWHGDNMLEPSSNMRWLKGWKVERINGNGEGKCGSXALDAILPPPRPTDQALRLPLPDVYKIGGIGTVPVGRLETGILKPGTVVVFAPANITTEV 238          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A1_XENLA (Elongation factor 1-alpha OS=Xenopus laevis PE=1 SV=2)

HSP 1 Score: 332.798 bits (852), Expect = 1.270e-90
Identity = 155/250 (62.00%), Postives = 197/250 (78.80%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWY------------KGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+ E  AA++ K SFK+AW+LDKLKAERERGITIDI+LWKF+T ++  T+IDAPGHRDFIKNMITGTSQAD A+L++ + TG FEAG+S++GQTREHALLA+T+GVKQ+I C NKMD T P YS  R+DE+V+ V  YLKK+GYNP  +PFVP+SG+ G+N+   S  + W+            KG +LL+ LD +  P RP++KPLRLPLQDVYKIGGIGTVPVG++ETG+LKPGM ++F PSG + EV
Sbjct:   43 EKVEAAAAQLGKSSFKFAWILDKLKAERERGITIDISLWKFQTNRFTITIIDAPGHRDFIKNMITGTSQADVALLVVSAATGEFEAGVSRNGQTREHALLAYTMGVKQLIVCVNKMDLTDPPYSHKRFDEVVRNVMVYLKKIGYNPATIPFVPVSGWTGENISSPSQKMGWFKGWKVKRKDGFTKGQSLLEVLDALVPPVRPANKPLRLPLQDVYKIGGIGTVPVGKIETGILKPGMTISFAPSGFSAEV 292          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_GIALA (Elongation factor 1-alpha (Fragment) OS=Giardia lamblia GN=TEF1 PE=2 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 2.928e-87
Identity = 155/239 (64.85%), Postives = 185/239 (77.41%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGY-NPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            + +EK A EM K SFKYAWVLD+LK ERERGITI+IALWKFET KY  T+IDAPGHRDFIKNMITGTSQAD A+L++ +  G FEAGISKDGQTREHA LA TLG+K MI C NKMD    KYSK RYDEI  E+   LK +G+   E+  ++P SG+ GDN++E+S  + WY+GP L+DA+D +  PKRP+DKPLRLP+QDVYKI G+GTVP GRVETG L PGM V F P+   +EV
Sbjct:   20 DEYEKRATEMGKGSFKYAWVLDQLKDERERGITINIALWKFETKKYIVTIIDAPGHRDFIKNMITGTSQADVAILVVAAGQGEFEAGISKDGQTREHATLANTLGIKTMIICVNKMDDGQVKYSKERYDEIKGEMMKQLKNIGWKKAEEFDYIPTSGWTGDNIMEKSDKMPWYEGPCLIDAIDGLKAPKRPTDKPLRLPIQDVYKISGVGTVPAGRVETGELAPGMKVVFAPTSQVSEV 258          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_HYPBU (Elongation factor 1-alpha OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403) GN=tuf PE=3 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 2.172e-82
Identity = 142/236 (60.17%), Postives = 183/236 (77.54%), Query Frame = 1
Query:   10 EKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDN-INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+EA +  K SFKYAW+LD+LK ERERG+TID+   KFET KYY T+IDAPGHRDF+KNMITG SQAD A+L++ +  G FEAG+S +GQTREH +LA T+G+ Q+I   NKMDAT P YSK RY++IV  +  ++K +GY  +++PF+P+S + G+N+IERS N+ WY GPTL++ALD  I  PK+P DKPLR+P+Q+VY I G+GTVPVGRVETGVLK G  V F P G+  EV
Sbjct:   43 EEEAKKKGKESFKYAWLLDRLKEERERGVTIDLTFVKFETKKYYFTIIDAPGHRDFVKNMITGASQADAAILVVSARRGEFEAGMSAEGQTREHLILAKTMGIDQLIVAVNKMDATEPPYSKQRYEQIVAFLKKFMKSLGYKVDQIPFIPVSAWTGENLIERSPNMPWYNGPTLVEALDTYIQPPKKPVDKPLRIPIQNVYSIPGVGTVPVGRVETGVLKVGDKVVFMPPGVVGEV 278          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_DESMO (Elongation factor 1-alpha OS=Desulfurococcus mobilis GN=tuf PE=3 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 2.836e-82
Identity = 139/238 (58.40%), Postives = 185/238 (77.73%), Query Frame = 1
Query:   10 EKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEVSLL 723
            E+E+ +M K SFK+AW+LD++K ERERG+TI ++  KFET KY+ T+IDAPGHRDF+KNMITG SQAD A+L++ +  G FEAG+S +GQTREHA+LA T+G+ Q+I   NKMDAT P YS+ RY+EI + +  +LK +GY+  K+PF+PIS + G+N+IERS N+ WY GPTL++ALD +  P +P +KPLR+P+QDVY I GIG VPVGRVETGVLK G  + F P+GL  EV  +
Sbjct:   44 EEESKKMGKESFKFAWLLDRMKEERERGVTISLSYMKFETKKYFFTIIDAPGHRDFVKNMITGASQADAAILVVSARKGEFEAGMSAEGQTREHAILARTMGINQLIVAINKMDATEPPYSEKRYNEIKEILGKFLKGLGYDVSKIPFIPISAWTGENLIERSPNMPWYNGPTLVEALDTLEVPPKPINKPLRIPIQDVYNISGIGVVPVGRVETGVLKVGDKLVFMPAGLVAEVKTI 281          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A2_EUPCR (Elongation factor 1-alpha 2 OS=Euplotes crassus GN=EFA2 PE=3 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 1.556e-80
Identity = 151/240 (62.92%), Postives = 186/240 (77.50%), Query Frame = 1
Query:    4 RFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEVSLL 723
            + E++A E+NK SFKYA+VLD LKAE+ERGITI+ AL +F+T     T+IDAPGH+DFIKNMITGTSQAD AVLII +  G FE G S++G T++HALLA+T+G+KQ I   NKMD  T  Y + R++EIV+ VS +L K+GY  E V ++PISGF+GDNM+E+S NL WYKGPTL +ALD    PKRP  KPLR+P+QDVYKI GIGTVPVGRVETGVLK GM V F  +G T+EV  L
Sbjct:   42 KLEEKALELNKASFKYAFVLDNLKAEQERGITINCALRQFDTPSRSYTIIDAPGHKDFIKNMITGTSQADAAVLIIAAKKGEFEDGFSREGSTKDHALLAYTMGIKQAIVAINKMD--TIDYDEERFNEIVENVSDHLGKIGYKKENVKYIPISGFDGDNMLEQSENLPWYKGPTLTEALDEFKVPKRPIKKPLRVPIQDVYKIAGIGTVPVGRVETGVLKRGMEVQF-TTGATSEVKSL 278          
The following BLAST results are available for this feature:
BLAST of DC900195 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_BLAHO1.267e-9873.75Elongation factor 1-alpha OS=Blastocystis hominis ... [more]
EF1A_CRYPV8.214e-9873.11Elongation factor 1-alpha OS=Cryptosporidium parvu... [more]
EF1A_STYLE5.324e-9772.57Elongation factor 1-alpha OS=Stylonychia lemnae GN... [more]
EF1A_PLAFK2.921e-9570.89Elongation factor 1-alpha OS=Plasmodium falciparum... [more]
EF1A_RHYAM1.500e-9171.31Elongation factor 1-alpha (Fragment) OS=Rhynchosci... [more]
EF1A1_XENLA1.270e-9062.00Elongation factor 1-alpha OS=Xenopus laevis PE=1 S... [more]
EF1A_GIALA2.928e-8764.85Elongation factor 1-alpha (Fragment) OS=Giardia la... [more]
EF1A_HYPBU2.172e-8260.17Elongation factor 1-alpha OS=Hyperthermus butylicu... [more]
EF1A_DESMO2.836e-8258.40Elongation factor 1-alpha OS=Desulfurococcus mobil... [more]
EF1A2_EUPCR1.556e-8062.92Elongation factor 1-alpha 2 OS=Euplotes crassus GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900195 VSS Citrus sinensis cDNA clone VS28233 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900195 ID=DC900195|Name=DC900195|organism=Citrus sinensis|type=EST|length=770bp
GAGAGGTTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCATCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTTGACTGGTACAAGGGTCCAACCCTGCTGGACGCTCTTGACAATA
TCAATGAGCCAAAGAGGCCCTCAGACAAGCCCCTTCGTCTGCCACTCCAG
GACGTGTACAAGATTGGTGGCATTGGAACCGTCCCAGTGGGTCGCGTTGA
GACCGGTGTCCTCAAGCCTGGTATGGNGGTGACATTTGGCCCCTCTGGAT
TGACAACTGAGGTAAGTCTGTTGAGATGCACCACGAGCTNTGCAGGAGGC
CTTCCGGTGACATGTTGGCT
back to top