DC900189

Overview
NameDC900189
Unique NameDC900189
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length605
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5641 contig Csv1_Contig5641:1..605. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP6_ARATH (Non-specific lipid-transfer protein 6 OS=Arabidopsis thaliana GN=LTP6 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 8.062e-14
Identity = 37/96 (38.54%), Postives = 51/96 (53.12%), Query Frame = 1
Query:  106 GQAAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDA--ATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            G+AA++C  V + L PCL+Y+T  G     CC G+  LK    T+ DRQ  C+CIK A          +  A +LP +CGVD+    +P  DC  I
Sbjct:   17 GEAAVSCNTVIADLYPCLSYVTQGGPVPTLCCNGLTTLKSQAQTSVDRQGVCRCIKSAIGGLTLSPRTIQNALELPSKCGVDLPYKFSPSTDCDSI 112          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLT21_PARJU (Probable non-specific lipid-transfer protein 2 OS=Parietaria judaica PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 8.062e-14
Identity = 38/90 (42.22%), Postives = 54/90 (60.00%), Query Frame = 1
Query:  124 CGQVDSFLAPCLAYLTGEGK-PSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGV-PITPDIDCSKI 387
            CG+V   + PCL ++ GE K PS+ CC+G + L +   TT  ++ ACKCI  A     GIK +   ++PK+C +   + PIT D DCSKI
Sbjct:   35 CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKI 124          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTPD_BRAOT (Non-specific lipid-transfer protein D OS=Brassica oleracea var. italica GN=WAX9D PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.375e-13
Identity = 38/94 (40.43%), Postives = 56/94 (59.57%), Query Frame = 1
Query:  112 AAITCGQVDSFLAPCLAYLTGEGKPS--RACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            AA++CG V  ++APC+ YL  +  P+   ACC+GV  L +   TT DRQ AC+C+  AA     I + +A  LPK CGV+I   I+   +C+ +
Sbjct:   25 AALSCGTVSGYVAPCIGYLA-QNAPAVPTACCSGVTSLNNMARTTPDRQQACRCLVGAANALPTINVARAAGLPKACGVNIPYKISKTTNCNSV 117          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTPC_RICCO (Non-specific lipid-transfer protein C, cotyledon-specific isoform OS=Ricinus communis PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 1.796e-13
Identity = 34/94 (36.17%), Postives = 57/94 (60.64%), Query Frame = 1
Query:  109 QAAITCGQVDSFLAPCLAYLTG-EGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            +AA+ C  VD   A C+ + TG + KPS+ACCTG++ L     T  D++A C+C+K A+++  GIK     ++P  C + +G P++ + +C  I
Sbjct:   23 EAAVPCSTVDMKAAACVGFATGKDSKPSQACCTGLQQLAQTVKTVDDKKAICRCLK-ASSKSLGIKDQFLSKIPAACNIKVGFPVSTNTNCETI 115          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP7_ARATH (Non-specific lipid-transfer protein 7 OS=Arabidopsis thaliana GN=LTP7 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.001e-13
Identity = 37/83 (44.58%), Postives = 50/83 (60.24%), Query Frame = 1
Query:  109 QAAITCGQVDSFLAPCLAYLTGEG--KPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRY-RGIKLDKARQLPKECGVDI 348
            +AA++CG+V+S L PC  YLT  G   P   CC GV  L     TT DR+ AC+CIK+AA     G+  D+A  +P+ CG+ I
Sbjct:   24 KAALSCGEVNSNLKPCTGYLTNGGITSPGPQCCNGVRKLNGMVLTTLDRRQACRCIKNAARNVGPGLNADRAAGIPRRCGIKI 106          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP1_ARATH (Non-specific lipid-transfer protein 1 OS=Arabidopsis thaliana GN=LTP1 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.001e-13
Identity = 38/93 (40.86%), Postives = 53/93 (56.99%), Query Frame = 1
Query:  112 AAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRY-RGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            AA++CG V+S LA C+ Y+   G    ACC+GV+ L     TT DRQ AC CI+ AA     G+   +A  +PK CGV+I   I+   +C  +
Sbjct:   25 AALSCGSVNSNLAACIGYVLQGGVIPPACCSGVKNLNSIAKTTPDRQQACNCIQGAARALGSGLNAGRAAGIPKACGVNIPYKISTSTNCKTV 117          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP6_AMBAR (Non-specific lipid-transfer protein OS=Ambrosia artemisiifolia PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 8.913e-13
Identity = 41/95 (43.16%), Postives = 56/95 (58.95%), Query Frame = 1
Query:  112 AAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQ--LPKECGVDIGVP-ITPDIDCSKI 387
            A+ TC  V + LAPC  +LTG+ +PS+ACCTGV  L ++  T ADR A C CIK+     + I  D  R   L  +CGV    P +  ++DCSK+
Sbjct:   26 ASPTCDTVQNILAPCAGFLTGQ-EPSKACCTGVNNLNNSRKTKADRVAVCNCIKELT---KSIAYDPKRMPLLSTKCGVKPDFPAVDKNLDCSKL 116          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTPA_ARATH (Non-specific lipid-transfer protein 10 OS=Arabidopsis thaliana GN=LTP10 PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.164e-12
Identity = 35/95 (36.84%), Postives = 50/95 (52.63%), Query Frame = 1
Query:  109 QAAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATR--YRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            +AAI+C  V + L PC+ Y+   G    +CC G+  L     + +D+Q  C+CIK    R  Y  I L KA  LP +CGV +   I P  +C+ I
Sbjct:   21 EAAISCNAVQANLYPCVVYVVQGGAIPYSCCNGIRMLSKQATSASDKQGVCRCIKSVVGRVSYSSIYLKKAAALPGKCGVKLPYKIDPSTNCNSI 115          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP5_ARATH (Non-specific lipid-transfer protein 5 OS=Arabidopsis thaliana GN=LTP5 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.520e-12
Identity = 41/95 (43.16%), Postives = 55/95 (57.89%), Query Frame = 1
Query:  109 QAAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLD--KARQLPKECGVDIGVPITPDIDCSKI 387
            +AAI+CG V   L  C  YLT  G   R CC+GV+ L     TT DRQ AC+CI+ AA R  G +L+  +A +LP  C V I  PI+   +C+ +
Sbjct:   24 EAAISCGAVTGSLGQCYNYLTRGGFIPRGCCSGVQRLNSLARTTRDRQQACRCIQGAA-RALGSRLNAGRAARLPGACRVRISYPISARTNCNTV 117          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTPD_RICCO (Non-specific lipid-transfer protein D, cotyledon-specific isoform OS=Ricinus communis PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.986e-12
Identity = 33/94 (35.11%), Postives = 55/94 (58.51%), Query Frame = 1
Query:  109 QAAITCGQVDSFLAPCLAYLTG-EGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            +AA+ C  VD   A C+ + TG + KPS ACCTG++ L     +  D++A C+C+K A+++  GIK     ++P  C + +G P++   +C  I
Sbjct:   23 EAAVPCSTVDMKAAACVGFATGKDSKPSSACCTGLQQLAQTVKSVDDKKAICRCLK-ASSKSLGIKDQFLSKIPAACNIKVGFPVSTATNCETI 115          
The following BLAST results are available for this feature:
BLAST of DC900189 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
NLTP6_ARATH8.062e-1438.54Non-specific lipid-transfer protein 6 OS=Arabidops... [more]
NLT21_PARJU8.062e-1442.22Probable non-specific lipid-transfer protein 2 OS=... [more]
NLTPD_BRAOT1.375e-1340.43Non-specific lipid-transfer protein D OS=Brassica ... [more]
NLTPC_RICCO1.796e-1336.17Non-specific lipid-transfer protein C, cotyledon-s... [more]
NLTP7_ARATH4.001e-1344.58Non-specific lipid-transfer protein 7 OS=Arabidops... [more]
NLTP1_ARATH4.001e-1340.86Non-specific lipid-transfer protein 1 OS=Arabidops... [more]
NLTP6_AMBAR8.913e-1343.16Non-specific lipid-transfer protein OS=Ambrosia ar... [more]
NLTPA_ARATH1.164e-1236.84Non-specific lipid-transfer protein 10 OS=Arabidop... [more]
NLTP5_ARATH1.520e-1243.16Non-specific lipid-transfer protein 5 OS=Arabidops... [more]
NLTPD_RICCO1.986e-1235.11Non-specific lipid-transfer protein D, cotyledon-s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900189 VSS Citrus sinensis cDNA clone VS28225 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900189 ID=DC900189|Name=DC900189|organism=Citrus sinensis|type=EST|length=605bp
AAAAACACCAAACACCTTCAAAATCCTCCAGCATTATTAGAAAACATGAA
AGCCGGTGTGGTTCTTGCTGTGATGTTACTGGCAGCGATCGTCATGGTGG
AGCGAGGCCAGGCAGCTATAACCTGCGGCCAAGTCGACTCCTTTCTAGCT
CCTTGCTTGGCATATCTGACCGGGGAAGGCAAGCCATCTCGGGCATGCTG
CACTGGTGTCGAGTATCTGAAAGACAACACTCCAACAACTGCAGACAGGC
AAGCTGCTTGTAAATGCATCAAAGATGCGGCAACTCGCTATCGCGGCATC
AAGCTGGACAAAGCTCGTCAACTCCCCAAAGAATGTGGCGTCGACATCGG
CGTTCCCATCACCCCCGATATCGACTGTAGCAAAATTTCTTAGAACCCCC
CACGGAGGCTTTGAGCTTGTGCGTTGAATAAACATCTCTGCCAGCTGGAG
AAAACACAGCACAATTAATATACATGAGCTAATTAAGCTTGTTAATTTAT
GCTGCTTGTTATGGTTCTTGCTGAAGAACTTTTTGTATCGGGATACTTTT
AGTGCATGGTGTTTTAGCACATAATTAGCGTTAATAAAACGAGAGTTATT
ACCTC
back to top