DC900183

Overview
NameDC900183
Unique NameDC900183
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length672
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8429 contig Csv1_Contig8429:927..1598. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAN2_ORYSJ (GTP-binding nuclear protein Ran-2 OS=Oryza sativa subsp. japonica GN=RAN2 PE=2 SV=1)

HSP 1 Score: 395.586 bits (1015), Expect = 1.241e-109
Identity = 187/195 (95.90%), Postives = 190/195 (97.44%), Query Frame = 2
Query:   44 MALPSQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLA 628
            MALP+Q TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVT+RLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVE+ AL PPEV IDLA
Sbjct:    1 MALPNQGTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFTTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVEAVALKPPEVPIDLA 195          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAN2_ORYSI (GTP-binding nuclear protein Ran-2 OS=Oryza sativa subsp. indica GN=RAN2 PE=2 SV=1)

HSP 1 Score: 395.586 bits (1015), Expect = 1.241e-109
Identity = 187/195 (95.90%), Postives = 190/195 (97.44%), Query Frame = 2
Query:   44 MALPSQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLA 628
            MALP+Q TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVT+RLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVE+ AL PPEV IDLA
Sbjct:    1 MALPNQGTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFTTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVEAVALKPPEVPIDLA 195          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAN1B_LOTJA (GTP-binding nuclear protein Ran1B (Fragment) OS=Lotus japonicus GN=RAN1B PE=2 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 4.415e-107
Identity = 182/183 (99.45%), Postives = 183/183 (100.00%), Query Frame = 2
Query:   80 SFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLA 628
            +FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLA
Sbjct:    1 NFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLA 183          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAN1A_LOTJA (GTP-binding nuclear protein Ran1A (Fragment) OS=Lotus japonicus GN=RAN1A PE=2 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 4.415e-107
Identity = 182/183 (99.45%), Postives = 183/183 (100.00%), Query Frame = 2
Query:   80 SFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLA 628
            +FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLA
Sbjct:    1 NFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLA 183          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAN3_ORYSJ (GTP-binding nuclear protein Ran-3 OS=Oryza sativa subsp. japonica GN=RAN3 PE=2 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 2.272e-95
Identity = 162/197 (82.23%), Postives = 176/197 (89.34%), Query Frame = 2
Query:   35 TQLMALPSQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDL 625
            ++  ALP    V YPSFKL++VGDGGTGKTTFVKRH+TGEFEK+YEPTIGVEV PLDF T+ GK+RF CWDTAGQEKFGGLRDGYYIHG CAIIMFDVT+RLTYKNVPTWH+D+CRVC+NIPIVLCGNKVD+KNRQVKAK VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKL GD NL FVE  AL P +V IDL
Sbjct:    2 SRAQALPDPAAVGYPSFKLILVGDGGTGKTTFVKRHITGEFEKRYEPTIGVEVRPLDFHTSRGKVRFCCWDTAGQEKFGGLRDGYYIHGHCAIIMFDVTSRLTYKNVPTWHKDICRVCDNIPIVLCGNKVDMKNRQVKAKMVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLTGDMNLRFVEELALLPADVTIDL 198          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAN3_ORYSI (GTP-binding nuclear protein Ran-3 OS=Oryza sativa subsp. indica GN=RAN3 PE=2 SV=2)

HSP 1 Score: 348.206 bits (892), Expect = 2.272e-95
Identity = 162/197 (82.23%), Postives = 176/197 (89.34%), Query Frame = 2
Query:   35 TQLMALPSQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDL 625
            ++  ALP    V YPSFKL++VGDGGTGKTTFVKRH+TGEFEK+YEPTIGVEV PLDF T+ GK+RF CWDTAGQEKFGGLRDGYYIHG CAIIMFDVT+RLTYKNVPTWH+D+CRVC+NIPIVLCGNKVD+KNRQVKAK VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKL GD NL FVE  AL P +V IDL
Sbjct:    2 SRAQALPDPAAVGYPSFKLILVGDGGTGKTTFVKRHITGEFEKRYEPTIGVEVRPLDFHTSRGKVRFCCWDTAGQEKFGGLRDGYYIHGHCAIIMFDVTSRLTYKNVPTWHKDICRVCDNIPIVLCGNKVDMKNRQVKAKMVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLTGDMNLRFVEELALLPADVTIDL 198          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: GSP2_YEAST (GTP-binding nuclear protein GSP2/CNR2 OS=Saccharomyces cerevisiae GN=GSP2 PE=1 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 6.842e-92
Identity = 157/193 (81.35%), Postives = 174/193 (90.16%), Query Frame = 2
Query:   44 MALPSQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQID 622
            M+ P+Q   + P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  TIGVEVHPL F+TN G+I+F  WDTAGQEKFGGLRDGYYI+ QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVDVK R+VKAK +TFHRKKNLQYY+ISAKSNYNFEKPFL+LARKLAG+P L FV SPALAPPEVQ+D
Sbjct:    1 MSAPAQNNAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVD 193          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAN_CAEEL (GTP-binding nuclear protein ran-1 OS=Caenorhabditis elegans GN=ran-1 PE=1 SV=1)

HSP 1 Score: 330.872 bits (847), Expect = 3.754e-90
Identity = 157/184 (85.33%), Postives = 168/184 (91.30%), Query Frame = 2
Query:   77 PSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLA 628
            P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL F TN G+IRF  WDTAGQEKFGGLRDGYYI GQCAIIMFDVTAR+TYKNVP WHRDL RVCENIPIVLCGNKVDVK+R+VKAK +TFHRKKNLQYY+ISAKSNYNFEKPFL+LARKL GDPNL FV  PALAPPEVQ+D A
Sbjct:    8 PTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTARVTYKNVPNWHRDLARVCENIPIVLCGNKVDVKDRKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLLGDPNLEFVAMPALAPPEVQMDPA 191          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: GSP1_YEAST (GTP-binding nuclear protein GSP1/CNR1 OS=Saccharomyces cerevisiae GN=GSP1 PE=1 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 8.364e-90
Identity = 154/184 (83.70%), Postives = 169/184 (91.85%), Query Frame = 2
Query:   71 DYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQID 622
            + P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  TIGVEVHPL F+TN G+I+F  WDTAGQEKFGGLRDGYYI+ QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVDVK R+VKAK +TFHRKKNLQYY+ISAKSNYNFEKPFL+LARKLAG+P L FV SPALAPPEVQ+D
Sbjct:    9 EVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVD 192          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: GSP1_ASHGO (GTP-binding nuclear protein GSP1/Ran OS=Ashbya gossypii GN=GSP1 PE=3 SV=1)

HSP 1 Score: 327.02 bits (837), Expect = 5.421e-89
Identity = 153/184 (83.15%), Postives = 168/184 (91.30%), Query Frame = 2
Query:   71 DYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQID 622
            + P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  TIGVEVHPL F+TN G+I+F  WDTAGQEKFGGLRDGYYI+ QC IIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVDVK R+VKAK +TFHRKKNLQYY+ISAKSNYNFEKPFL+LARKLAG+P L FV SPALAPPEVQ+D
Sbjct:    4 EVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLDFVASPALAPPEVQVD 187          
The following BLAST results are available for this feature:
BLAST of DC900183 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RAN2_ORYSJ1.241e-10995.90GTP-binding nuclear protein Ran-2 OS=Oryza sativa ... [more]
RAN2_ORYSI1.241e-10995.90GTP-binding nuclear protein Ran-2 OS=Oryza sativa ... [more]
RAN1B_LOTJA4.415e-10799.45GTP-binding nuclear protein Ran1B (Fragment) OS=Lo... [more]
RAN1A_LOTJA4.415e-10799.45GTP-binding nuclear protein Ran1A (Fragment) OS=Lo... [more]
RAN3_ORYSJ2.272e-9582.23GTP-binding nuclear protein Ran-3 OS=Oryza sativa ... [more]
RAN3_ORYSI2.272e-9582.23GTP-binding nuclear protein Ran-3 OS=Oryza sativa ... [more]
GSP2_YEAST6.842e-9281.35GTP-binding nuclear protein GSP2/CNR2 OS=Saccharom... [more]
RAN_CAEEL3.754e-9085.33GTP-binding nuclear protein ran-1 OS=Caenorhabditi... [more]
GSP1_YEAST8.364e-9083.70GTP-binding nuclear protein GSP1/CNR1 OS=Saccharom... [more]
GSP1_ASHGO5.421e-8983.15GTP-binding nuclear protein GSP1/Ran OS=Ashbya gos... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900183 VSS Citrus sinensis cDNA clone VS28210 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900183 ID=DC900183|Name=DC900183|organism=Citrus sinensis|type=EST|length=672bp
CAGACCGCGAACTTCGTATTCTTTCGCACACAGTACTCAACTCATGGCTC
TGCCAAGTCAGCAAACTGTTGATTACCCGAGCTTCAAACTCGTCATAGTC
GGCGACGGTGGCACTGGGAAGACTACCTTTGTGAAGAGGCATCTGACTGG
GGAGTTTGAGAAGAAGTATGAACCAACTATTGGTGTGGAGGTTCATCCGT
TGGATTTCTTTACAAATTGTGGCAAAATCCGTTTCTACTGCTGGGACACT
GCTGGCCAGGAAAAGTTTGGTGGTCTTAGAGATGGTTATTACATCCATGG
GCAATGTGCCATCATTATGTTTGATGTTACTGCCCGATTGACATACAAGA
ATGTTCCCACTTGGCACCGTGATCTTTGCCGGGTGTGTGAAAATATACCG
ATTGTTCTCTGTGGGAACAAGGTTGATGTGAAGAATAGGCAAGTCAAGGC
AAAGCAGGTTACCTTCCACAGGAAGAAGAATCTACAGTACTATGAGATTT
CTGCCAAGAGCAACTACAATTTTGAGAAACCTTTCTTGTACCTTGCCAGG
AAGCTTGCTGGGGACCCAAATTTGCACTTCGTGGAATCTCCTGCTCTCGC
TCCTCCAGAAGTACAGATTGACTTAGCTGACAGCAACACATGAAGCCGAG
CTTGCCGANCAGCTAGCCAGCC
back to top