DC900183

Overview
NameDC900183
Unique NameDC900183
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length672
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8429 contig Csv1_Contig8429:927..1598. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAN_MOUSE (GTP-binding nuclear protein Ran OS=Mus musculus GN=Ran PE=1 SV=3)

HSP 1 Score: 317.39 bits (812), Expect = 4.296e-86
Identity = 150/182 (82.42%), Postives = 162/182 (89.01%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLA 628
            FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL F TN G I+F  WDTAGQEKFGGLRDGYYI  QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKKNLQYY+ISAKSNYNFEKPFL+LARKL GDPNL FV  PALAPPEV +D A
Sbjct:   11 FKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA 192          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAN_MACFA (GTP-binding nuclear protein Ran OS=Macaca fascicularis GN=RAN PE=2 SV=3)

HSP 1 Score: 317.39 bits (812), Expect = 4.296e-86
Identity = 150/182 (82.42%), Postives = 162/182 (89.01%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLA 628
            FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL F TN G I+F  WDTAGQEKFGGLRDGYYI  QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKKNLQYY+ISAKSNYNFEKPFL+LARKL GDPNL FV  PALAPPEV +D A
Sbjct:   11 FKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA 192          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAN_HUMAN (GTP-binding nuclear protein Ran OS=Homo sapiens GN=RAN PE=1 SV=3)

HSP 1 Score: 317.39 bits (812), Expect = 4.296e-86
Identity = 150/182 (82.42%), Postives = 162/182 (89.01%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLA 628
            FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL F TN G I+F  WDTAGQEKFGGLRDGYYI  QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKKNLQYY+ISAKSNYNFEKPFL+LARKL GDPNL FV  PALAPPEV +D A
Sbjct:   11 FKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA 192          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAN_CHICK (GTP-binding nuclear protein Ran OS=Gallus gallus GN=RAN PE=2 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 4.296e-86
Identity = 150/182 (82.42%), Postives = 162/182 (89.01%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLA 628
            FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL F TN G I+F  WDTAGQEKFGGLRDGYYI  QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKKNLQYY+ISAKSNYNFEKPFL+LARKL GDPNL FV  PALAPPEV +D A
Sbjct:   11 FKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA 192          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAN_CANFA (GTP-binding nuclear protein Ran OS=Canis familiaris GN=RAN PE=1 SV=3)

HSP 1 Score: 317.39 bits (812), Expect = 4.296e-86
Identity = 150/182 (82.42%), Postives = 162/182 (89.01%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLA 628
            FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL F TN G I+F  WDTAGQEKFGGLRDGYYI  QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKKNLQYY+ISAKSNYNFEKPFL+LARKL GDPNL FV  PALAPPEV +D A
Sbjct:   11 FKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA 192          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAN_BOVIN (GTP-binding nuclear protein Ran OS=Bos taurus GN=RAN PE=2 SV=3)

HSP 1 Score: 317.39 bits (812), Expect = 4.296e-86
Identity = 150/182 (82.42%), Postives = 162/182 (89.01%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLA 628
            FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL F TN G I+F  WDTAGQEKFGGLRDGYYI  QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKKNLQYY+ISAKSNYNFEKPFL+LARKL GDPNL FV  PALAPPEV +D A
Sbjct:   11 FKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA 192          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAN_XENTR (GTP-binding nuclear protein Ran OS=Xenopus tropicalis GN=ran PE=2 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 1.250e-85
Identity = 149/182 (81.87%), Postives = 161/182 (88.46%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLA 628
            FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL F TN G I+F  WDTAGQEKFGGLRDGYYI  QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKKNLQYY+ISAKSNYNFEKPFL+LARKL GDPN  FV  PALAPPEV +D A
Sbjct:   11 FKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNFEFVAMPALAPPEVVMDPA 192          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAN_SALSA (GTP-binding nuclear protein Ran OS=Salmo salar GN=ran PE=2 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 1.632e-85
Identity = 147/180 (81.67%), Postives = 161/180 (89.44%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQID 622
            FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL F TN G I++  WDTAGQEKFGGLRDGYYI  QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKKNLQYY+ISAKSNYNFEKPFL+LARKL GDPNL FV  PALAPPE+ +D
Sbjct:   10 FKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGAIKYNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEILMD 189          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAN_CARAU (GTP-binding nuclear protein Ran OS=Carassius auratus GN=ran PE=2 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 2.132e-85
Identity = 147/180 (81.67%), Postives = 161/180 (89.44%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQID 622
            FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL F TN G I++  WDTAGQEKFGGLRDGYYI  QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKKNLQYY+ISAKSNYNFEKPFL+LARKL GDPNL FVE  ALAPPE+ +D
Sbjct:   10 FKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKYNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVEMSALAPPEIAMD 189          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: GSP1_NEUCR (GTP-binding nuclear protein GSP1/Ran OS=Neurospora crassa GN=gsp-1 PE=2 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 6.203e-85
Identity = 147/182 (80.77%), Postives = 162/182 (89.01%), Query Frame = 2
Query:   77 PSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQID 622
            P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL F TN G+I+F  WDTAGQEKFGGLRDGYYI+GQC IIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVDVK R+VKAK +TFHRKKNLQYY+ISAKSNYNFEKPFL+LARKL G+  L FV +PALAPP   +D
Sbjct:    6 PTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYMATLGVEVHPLGFSTNFGQIQFDVWDTAGQEKFGGLRDGYYINGQCGIIMFDVTSRITYKNVPNWHRDLTRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGNNALEFVAAPALAPPTAVVD 187          
The following BLAST results are available for this feature:
BLAST of DC900183 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RAN_MOUSE4.296e-8682.42GTP-binding nuclear protein Ran OS=Mus musculus GN... [more]
RAN_MACFA4.296e-8682.42GTP-binding nuclear protein Ran OS=Macaca fascicul... [more]
RAN_HUMAN4.296e-8682.42GTP-binding nuclear protein Ran OS=Homo sapiens GN... [more]
RAN_CHICK4.296e-8682.42GTP-binding nuclear protein Ran OS=Gallus gallus G... [more]
RAN_CANFA4.296e-8682.42GTP-binding nuclear protein Ran OS=Canis familiari... [more]
RAN_BOVIN4.296e-8682.42GTP-binding nuclear protein Ran OS=Bos taurus GN=R... [more]
RAN_XENTR1.250e-8581.87GTP-binding nuclear protein Ran OS=Xenopus tropica... [more]
RAN_SALSA1.632e-8581.67GTP-binding nuclear protein Ran OS=Salmo salar GN=... [more]
RAN_CARAU2.132e-8581.67GTP-binding nuclear protein Ran OS=Carassius aurat... [more]
GSP1_NEUCR6.203e-8580.77GTP-binding nuclear protein GSP1/Ran OS=Neurospora... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900183 VSS Citrus sinensis cDNA clone VS28210 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900183 ID=DC900183|Name=DC900183|organism=Citrus sinensis|type=EST|length=672bp
CAGACCGCGAACTTCGTATTCTTTCGCACACAGTACTCAACTCATGGCTC
TGCCAAGTCAGCAAACTGTTGATTACCCGAGCTTCAAACTCGTCATAGTC
GGCGACGGTGGCACTGGGAAGACTACCTTTGTGAAGAGGCATCTGACTGG
GGAGTTTGAGAAGAAGTATGAACCAACTATTGGTGTGGAGGTTCATCCGT
TGGATTTCTTTACAAATTGTGGCAAAATCCGTTTCTACTGCTGGGACACT
GCTGGCCAGGAAAAGTTTGGTGGTCTTAGAGATGGTTATTACATCCATGG
GCAATGTGCCATCATTATGTTTGATGTTACTGCCCGATTGACATACAAGA
ATGTTCCCACTTGGCACCGTGATCTTTGCCGGGTGTGTGAAAATATACCG
ATTGTTCTCTGTGGGAACAAGGTTGATGTGAAGAATAGGCAAGTCAAGGC
AAAGCAGGTTACCTTCCACAGGAAGAAGAATCTACAGTACTATGAGATTT
CTGCCAAGAGCAACTACAATTTTGAGAAACCTTTCTTGTACCTTGCCAGG
AAGCTTGCTGGGGACCCAAATTTGCACTTCGTGGAATCTCCTGCTCTCGC
TCCTCCAGAAGTACAGATTGACTTAGCTGACAGCAACACATGAAGCCGAG
CTTGCCGANCAGCTAGCCAGCC
back to top