DC900183

Overview
NameDC900183
Unique NameDC900183
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length672
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8429 contig Csv1_Contig8429:927..1598. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: GSP1_ENCCU (GTP-binding nuclear protein GSP1 OS=Encephalitozoon cuniculi GN=GSP1 PE=1 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 4.209e-41
Identity = 87/185 (47.03%), Postives = 119/185 (64.32%), Query Frame = 2
Query:   80 SFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGK-IRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCEN-IPIVLCGNKVDVKNRQVKAKQVTFH--RKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQID 622
            ++K+ ++GDGG GKTT++ R L G FEK Y  T+G   HP+ F  + G  I+F  WDTAGQEK   L+D YYI    AI  FDVT+R+T +N+  W ++   V  N  PIV+C NK+D+KNRQ  +K++     + KN +Y+EISAK+ +NF  PFL+LAR   G P+L FV +  L P EV  D
Sbjct:    7 TYKICLIGDGGVGKTTYINRVLDGRFEKNYNATVGAVNHPVTFLDDQGNVIKFNVWDTAGQEKKAVLKDVYYIGASGAIFFFDVTSRITCQNLARWVKEFQAVVGNEAPIVVCANKIDIKNRQKISKKLVMEVLKGKNYEYFEISAKTAHNFGLPFLHLARIFTGRPDLIFVSNVNLEPTEVNYD 191          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB7A_RABIT (Ras-related protein Rab-7a OS=Oryctolagus cuniculus GN=RAB7A PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.898e-25
Identity = 59/162 (36.42%), Postives = 92/162 (56.79%), Query Frame = 2
Query:   86 KLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLC-----RVCENIPIVLCGNKVDVKNRQVKAK--QVTFHRKKNLQYYEISAKSNYNFEKPFLYLAR 550
            K++I+GD G GKT+ + +++  +F  +Y+ TIG +    +   +   +    WDTAGQE+F  L   +Y    C +++FDVTA  T+K + +W  +       R  EN P V+ GNK+D++NRQV  K  Q   + K N+ Y+E SAK   N E+ F  +AR
Sbjct:   10 KVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLSVAFYRGADCCVLVFDVTAPNTFKTLDSWRLEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWSYSKNNIPYFETSAKEAINVEQAFQTIAR 171          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB7A_RAT (Ras-related protein Rab-7a OS=Rattus norvegicus GN=Rab7a PE=1 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 2.479e-25
Identity = 59/162 (36.42%), Postives = 92/162 (56.79%), Query Frame = 2
Query:   86 KLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLC-----RVCENIPIVLCGNKVDVKNRQVKAK--QVTFHRKKNLQYYEISAKSNYNFEKPFLYLAR 550
            K++I+GD G GKT+ + +++  +F  +Y+ TIG +    +   +   +    WDTAGQE+F  L   +Y    C +++FDVTA  T+K + +W  +       R  EN P V+ GNK+D++NRQV  K  Q   + K N+ Y+E SAK   N E+ F  +AR
Sbjct:   10 KVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIAR 171          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB7A_PONAB (Ras-related protein Rab-7a OS=Pongo abelii GN=RAB7A PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 2.479e-25
Identity = 59/162 (36.42%), Postives = 92/162 (56.79%), Query Frame = 2
Query:   86 KLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLC-----RVCENIPIVLCGNKVDVKNRQVKAK--QVTFHRKKNLQYYEISAKSNYNFEKPFLYLAR 550
            K++I+GD G GKT+ + +++  +F  +Y+ TIG +    +   +   +    WDTAGQE+F  L   +Y    C +++FDVTA  T+K + +W  +       R  EN P V+ GNK+D++NRQV  K  Q   + K N+ Y+E SAK   N E+ F  +AR
Sbjct:   10 KVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIAR 171          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB7A_MOUSE (Ras-related protein Rab-7a OS=Mus musculus GN=Rab7a PE=1 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 2.479e-25
Identity = 59/162 (36.42%), Postives = 92/162 (56.79%), Query Frame = 2
Query:   86 KLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLC-----RVCENIPIVLCGNKVDVKNRQVKAK--QVTFHRKKNLQYYEISAKSNYNFEKPFLYLAR 550
            K++I+GD G GKT+ + +++  +F  +Y+ TIG +    +   +   +    WDTAGQE+F  L   +Y    C +++FDVTA  T+K + +W  +       R  EN P V+ GNK+D++NRQV  K  Q   + K N+ Y+E SAK   N E+ F  +AR
Sbjct:   10 KVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIAR 171          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB7A_HUMAN (Ras-related protein Rab-7a OS=Homo sapiens GN=RAB7A PE=1 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 2.479e-25
Identity = 59/162 (36.42%), Postives = 92/162 (56.79%), Query Frame = 2
Query:   86 KLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLC-----RVCENIPIVLCGNKVDVKNRQVKAK--QVTFHRKKNLQYYEISAKSNYNFEKPFLYLAR 550
            K++I+GD G GKT+ + +++  +F  +Y+ TIG +    +   +   +    WDTAGQE+F  L   +Y    C +++FDVTA  T+K + +W  +       R  EN P V+ GNK+D++NRQV  K  Q   + K N+ Y+E SAK   N E+ F  +AR
Sbjct:   10 KVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIAR 171          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB7A_CANFA (Ras-related protein Rab-7a OS=Canis familiaris GN=RAB7A PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 2.479e-25
Identity = 59/162 (36.42%), Postives = 92/162 (56.79%), Query Frame = 2
Query:   86 KLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLC-----RVCENIPIVLCGNKVDVKNRQVKAK--QVTFHRKKNLQYYEISAKSNYNFEKPFLYLAR 550
            K++I+GD G GKT+ + +++  +F  +Y+ TIG +    +   +   +    WDTAGQE+F  L   +Y    C +++FDVTA  T+K + +W  +       R  EN P V+ GNK+D++NRQV  K  Q   + K N+ Y+E SAK   N E+ F  +AR
Sbjct:   10 KVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIAR 171          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB7A_BOVIN (Ras-related protein Rab-7a OS=Bos taurus GN=RAB7A PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 7.213e-25
Identity = 58/162 (35.80%), Postives = 91/162 (56.17%), Query Frame = 2
Query:   86 KLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLC-----RVCENIPIVLCGNKVDVKNRQVKAK--QVTFHRKKNLQYYEISAKSNYNFEKPFLYLAR 550
            K++I+GD G GKT+ + +++  +F  +Y+ TIG +    +   +   +    WDTAGQE+F  L   +Y    C +++FDVTA  T+K + +W  +       R  EN P V+ GNK+D++NRQV  K  Q   + K N+ Y+E SAK   N E+ F  + R
Sbjct:   10 KVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIVR 171          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB23_HUMAN (Ras-related protein Rab-23 OS=Homo sapiens GN=RAB23 PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 3.351e-22
Identity = 57/179 (31.84%), Postives = 90/179 (50.28%), Query Frame = 2
Query:   80 SFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVD------VKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPAL 598
            + K+V+VG+G  GK++ ++R+  G F K Y+ TIGV+        N   +R   WDTAGQE+F  +   YY   Q  +++F  T R +++ V +W   +     +IP VL  NK+D      +KN + +A      ++  L++Y  S K + N  + F YLA K          E P L
Sbjct:    9 AIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEA----LAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPEL 183          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB9A_MOUSE (Ras-related protein Rab-9A OS=Mus musculus GN=Rab9a PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 7.465e-22
Identity = 56/178 (31.46%), Postives = 94/178 (52.81%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDL-----CRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKN--LQYYEISAKSNYNFEKPFLYLARKLAG--DPNLHFVES 589
            FK++++GDGG GK++ + R++T +F+ +   TIGVE    D   +   +    WDTAGQE+F  LR  +Y    C ++ F V    +++N+  W ++       +  E+ P V+ GNK D+K RQV  ++     K N    Y+E SAK + N    F    R++    D + H +++
Sbjct:    8 FKIILLGDGGVGKSSLMNRYVTNKFDSQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKTDIKERQVSTEEAQAWCKDNGDYPYFETSAKDSTNVAAAFEEAVRRILATEDRSEHLIQT 185          
The following BLAST results are available for this feature:
BLAST of DC900183 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
GSP1_ENCCU4.209e-4147.03GTP-binding nuclear protein GSP1 OS=Encephalitozoo... [more]
RAB7A_RABIT1.898e-2536.42Ras-related protein Rab-7a OS=Oryctolagus cuniculu... [more]
RAB7A_RAT2.479e-2536.42Ras-related protein Rab-7a OS=Rattus norvegicus GN... [more]
RAB7A_PONAB2.479e-2536.42Ras-related protein Rab-7a OS=Pongo abelii GN=RAB7... [more]
RAB7A_MOUSE2.479e-2536.42Ras-related protein Rab-7a OS=Mus musculus GN=Rab7... [more]
RAB7A_HUMAN2.479e-2536.42Ras-related protein Rab-7a OS=Homo sapiens GN=RAB7... [more]
RAB7A_CANFA2.479e-2536.42Ras-related protein Rab-7a OS=Canis familiaris GN=... [more]
RAB7A_BOVIN7.213e-2535.80Ras-related protein Rab-7a OS=Bos taurus GN=RAB7A ... [more]
RAB23_HUMAN3.351e-2231.84Ras-related protein Rab-23 OS=Homo sapiens GN=RAB2... [more]
RAB9A_MOUSE7.465e-2231.46Ras-related protein Rab-9A OS=Mus musculus GN=Rab9... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900183 VSS Citrus sinensis cDNA clone VS28210 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900183 ID=DC900183|Name=DC900183|organism=Citrus sinensis|type=EST|length=672bp
CAGACCGCGAACTTCGTATTCTTTCGCACACAGTACTCAACTCATGGCTC
TGCCAAGTCAGCAAACTGTTGATTACCCGAGCTTCAAACTCGTCATAGTC
GGCGACGGTGGCACTGGGAAGACTACCTTTGTGAAGAGGCATCTGACTGG
GGAGTTTGAGAAGAAGTATGAACCAACTATTGGTGTGGAGGTTCATCCGT
TGGATTTCTTTACAAATTGTGGCAAAATCCGTTTCTACTGCTGGGACACT
GCTGGCCAGGAAAAGTTTGGTGGTCTTAGAGATGGTTATTACATCCATGG
GCAATGTGCCATCATTATGTTTGATGTTACTGCCCGATTGACATACAAGA
ATGTTCCCACTTGGCACCGTGATCTTTGCCGGGTGTGTGAAAATATACCG
ATTGTTCTCTGTGGGAACAAGGTTGATGTGAAGAATAGGCAAGTCAAGGC
AAAGCAGGTTACCTTCCACAGGAAGAAGAATCTACAGTACTATGAGATTT
CTGCCAAGAGCAACTACAATTTTGAGAAACCTTTCTTGTACCTTGCCAGG
AAGCTTGCTGGGGACCCAAATTTGCACTTCGTGGAATCTCCTGCTCTCGC
TCCTCCAGAAGTACAGATTGACTTAGCTGACAGCAACACATGAAGCCGAG
CTTGCCGANCAGCTAGCCAGCC
back to top