DC900183

Overview
NameDC900183
Unique NameDC900183
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length672
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8429 contig Csv1_Contig8429:927..1598. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB9A_RAT (Ras-related protein Rab-9A OS=Rattus norvegicus GN=Rab9a PE=2 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 9.749e-22
Identity = 56/178 (31.46%), Postives = 94/178 (52.81%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDL-----CRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKN--LQYYEISAKSNYNFEKPFLYLARKLAG--DPNLHFVES 589
            FK++++GDGG GK++ + R++T +F+ +   TIGVE    D   +   +    WDTAGQE+F  LR  +Y    C ++ F V    +++N+  W ++       +  E+ P V+ GNK D+K RQV  ++     K N    Y+E SAK + N    F    R++    D + H +++
Sbjct:    8 FKIILLGDGGVGKSSLMNRYVTNKFDSQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKTDIKERQVSTEEAQAWCKDNGDYPYFETSAKDSTNVAAAFEEAVRRILATEDRSDHLIQT 185          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB7A_DICDI (Ras-related protein Rab-7A OS=Dictyostelium discoideum GN=rab7A PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.172e-21
Identity = 52/163 (31.90%), Postives = 88/163 (53.99%), Query Frame = 2
Query:   86 KLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLC-----RVCENIPIVLCGNKVDVKNRQV---KAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLAR 550
            K++I+GD G GKT+ + +++  +F  +Y+ TIG +    +   +   +    WDTAGQE+F  L   +Y    C ++ +DV    T++N+ +W  +       R  +N P V+ GNK+D++N++V   K        K N+ Y+E SAK   N E+ F  +AR
Sbjct:   10 KVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKELMVDDRVVTMQIWDTAGQERFQSLGVAFYRGADCCVLCYDVNVAKTFENLDSWRDEFLIQAGPRDPDNFPFVVLGNKIDLENQRVVSQKRAASWCQSKGNIPYFETSAKEAINVEQAFQTIAR 172          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB19_XENTR (Ras-related protein Rab-19 OS=Xenopus tropicalis GN=rab19 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.172e-21
Identity = 62/191 (32.46%), Postives = 100/191 (52.36%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRV-CENIPIVLCGNKVDV-KNRQVKAKQVTFHRKKN--LQYYEISAKSNYNFEKPFLYLARKLAGDPNLHF-----------VESPALAPPE 610
            FK++++GD   GKT  V R  +G F    + TIGV+    +   N  K++   WDTAGQE+F  +   YY     AII +D+T R ++++VP W  +  +    N+ ++L GNK D+ + RQ+  ++     +K+  L   E SAK ++N ++ FL +A++L      H+              P LAPPE
Sbjct:   16 FKIILIGDSNVGKTCVVHRFQSGVFAHNQQNTIGVDFTVRNMNINGKKVKVQVWDTAGQERFRTITQSYYRSAHGAIIAYDITRRQSFESVPHWIYEAEKYGAANLMMMLIGNKSDLAEKRQILFEEACTLAEKHGLLAVLETSAKESHNVDEVFLLMAKELIARNTFHYHSESPRNSFMLDSKPVLAPPE 206          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RBH1C_ARATH (Ras-related protein RABH1C OS=Arabidopsis thaliana GN=RABH1C PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.837e-21
Identity = 60/164 (36.59%), Postives = 87/164 (53.05%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRV--CENIPIVLCGNKVD-VKNRQVKAKQVTFHRKK-NLQYYEISAKSNYNFEKPFLYLARKLAG 562
            FKLV +GD   GKT+ + R +  +F+  Y+PTIG++      +     +R   WDTAGQE+F  L   Y      AI+++DV+ R T+ N   W  D+ R     N+ IVL GNK D V+ RQV   +     K+  + + E SAK N+N +  F  +A  L G
Sbjct:   10 FKLVFLGDQSVGKTSIITRFMYDKFDTTYQPTIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAIVVYDVSNRQTFLNTSKWIEDVHRERGQSNVIIVLVGNKTDLVEKRQVSISEGEDKGKEYGVMFIETSAKENFNIKALFRKIAAALPG 173          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RB11C_DICDI (Ras-related protein Rab-11C OS=Dictyostelium discoideum GN=rab11C PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.837e-21
Identity = 56/165 (33.94%), Postives = 94/165 (56.97%), Query Frame = 2
Query:   50 LPSQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCE-NIPIVLCGNKVDVK-NRQVKAKQV-TFHRKKNLQYYEISAKSNYNFEKPF 535
            +P ++  +Y  FK+VI+GD   GK+  + R    EF +K + TIGV+        +   I   CWDTAGQE+F  +  GYY     A+I++D+T+++++KNV  W  +L  + E +I I++ GNK D++ +R+V  K+   F     + + E SA ++ N  + F
Sbjct:    1 MPQEEEAEY-LFKIVIIGDSAVGKSNLLNRFTRNEFTEKTKATIGVDFGTKSIEIDNKTITAQCWDTAGQERFRAVTSGYYRGAVGAMIVYDITSKISFKNVTRWLNELREMAEQDILIMMVGNKSDLEMSREVPTKEAQAFAESNKISFLETSALNSTNVNQSF 164          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB30_MOUSE (Ras-related protein Rab-30 OS=Mus musculus GN=Rab30 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.837e-21
Identity = 57/164 (34.76%), Postives = 89/164 (54.27%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCEN-IPIVLCGNKVDVKNRQVKAKQ--VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD 565
            FK+V++G+ G GKT  V+R   G F      TIGV+        N  K++   WDTAGQE+F  +   YY      I+ +D+T   +++ +P W R++ +   N +  VL GNK+D+  R+  ++Q    F   +++ Y E SAK + N EK FL LA +L  +
Sbjct:   10 FKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISE 173          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB30_HUMAN (Ras-related protein Rab-30 OS=Homo sapiens GN=RAB30 PE=1 SV=2)

HSP 1 Score: 102.064 bits (253), Expect = 2.837e-21
Identity = 57/164 (34.76%), Postives = 89/164 (54.27%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCEN-IPIVLCGNKVDVKNRQVKAKQ--VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD 565
            FK+V++G+ G GKT  V+R   G F      TIGV+        N  K++   WDTAGQE+F  +   YY      I+ +D+T   +++ +P W R++ +   N +  VL GNK+D+  R+  ++Q    F   +++ Y E SAK + N EK FL LA +L  +
Sbjct:   10 FKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISE 173          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB30_BOVIN (Ras-related protein Rab-30 OS=Bos taurus GN=RAB30 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.837e-21
Identity = 57/164 (34.76%), Postives = 89/164 (54.27%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCEN-IPIVLCGNKVDVKNRQVKAKQ--VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD 565
            FK+V++G+ G GKT  V+R   G F      TIGV+        N  K++   WDTAGQE+F  +   YY      I+ +D+T   +++ +P W R++ +   N +  VL GNK+D+  R+  ++Q    F   +++ Y E SAK + N EK FL LA +L  +
Sbjct:   10 FKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISE 173          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB19_XENLA (Ras-related protein Rab-19 OS=Xenopus laevis GN=rab19 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.837e-21
Identity = 62/191 (32.46%), Postives = 99/191 (51.83%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRV-CENIPIVLCGNKVDV-KNRQVKAKQVTFHRKKN--LQYYEISAKSNYNFEKPFLYLARKLAGDPNLHF-----------VESPALAPPE 610
            FK++++GD   GKT  V R  +G F    + TIGV+        N  K++   WDTAGQE+F  +   YY     AII +D+T R ++++VP W  +  +    N+ ++L GNK D+ + RQ+  ++     +K+  L   E SAK ++N ++ FL +A++L      H+              P LAPPE
Sbjct:   16 FKIILIGDSNVGKTCVVHRFQSGIFMDNQQNTIGVDFTVRSLNINGKKVKVQVWDTAGQERFRTITQSYYRSAHGAIIAYDITRRQSFESVPHWIYEAGKYGAANLMLMLMGNKSDLAEKRQILFEEACTLAEKHGLLAVLETSAKESHNVDEVFLLMAKELIARNTFHYHNESPRNSFILDSKPVLAPPE 206          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RABJ_DICDI (Ras-related protein RabJ OS=Dictyostelium discoideum GN=rabJ PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.078e-20
Identity = 59/160 (36.88%), Postives = 87/160 (54.37%), Query Frame = 2
Query:   86 KLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDL-CRVCENIPIVLCGNKVDV-KNRQVKAKQVTFHRKK-NLQYYEISAKSNYNFEKPFLYLARKL 556
            K+V++G    GKT    R++ G F K+   TIG             KI++  WD+AGQ++F  L   YY     AI++FD+T + T+  V  W  +L   + E I +VLCGNK+D+ +NRQVK++    +  + N  Y E SAK N   E  FL + +KL
Sbjct:   11 KVVLLGSSDVGKTALSLRYVDGIFPKRLTSTIGASFLTRTINIEGNKIKYLIWDSAGQDRFRSLATLYYRGACVAILVFDITQQKTFDIVKGWVEELKANIQEEIIMVLCGNKIDLEQNRQVKSETAKLYADEINAMYVETSAKENEGVEGMFLEIGKKL 170          
The following BLAST results are available for this feature:
BLAST of DC900183 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RAB9A_RAT9.749e-2231.46Ras-related protein Rab-9A OS=Rattus norvegicus GN... [more]
RAB7A_DICDI2.172e-2131.90Ras-related protein Rab-7A OS=Dictyostelium discoi... [more]
RAB19_XENTR2.172e-2132.46Ras-related protein Rab-19 OS=Xenopus tropicalis G... [more]
RBH1C_ARATH2.837e-2136.59Ras-related protein RABH1C OS=Arabidopsis thaliana... [more]
RB11C_DICDI2.837e-2133.94Ras-related protein Rab-11C OS=Dictyostelium disco... [more]
RAB30_MOUSE2.837e-2134.76Ras-related protein Rab-30 OS=Mus musculus GN=Rab3... [more]
RAB30_HUMAN2.837e-2134.76Ras-related protein Rab-30 OS=Homo sapiens GN=RAB3... [more]
RAB30_BOVIN2.837e-2134.76Ras-related protein Rab-30 OS=Bos taurus GN=RAB30 ... [more]
RAB19_XENLA2.837e-2132.46Ras-related protein Rab-19 OS=Xenopus laevis GN=ra... [more]
RABJ_DICDI1.078e-2036.88Ras-related protein RabJ OS=Dictyostelium discoide... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900183 VSS Citrus sinensis cDNA clone VS28210 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900183 ID=DC900183|Name=DC900183|organism=Citrus sinensis|type=EST|length=672bp
CAGACCGCGAACTTCGTATTCTTTCGCACACAGTACTCAACTCATGGCTC
TGCCAAGTCAGCAAACTGTTGATTACCCGAGCTTCAAACTCGTCATAGTC
GGCGACGGTGGCACTGGGAAGACTACCTTTGTGAAGAGGCATCTGACTGG
GGAGTTTGAGAAGAAGTATGAACCAACTATTGGTGTGGAGGTTCATCCGT
TGGATTTCTTTACAAATTGTGGCAAAATCCGTTTCTACTGCTGGGACACT
GCTGGCCAGGAAAAGTTTGGTGGTCTTAGAGATGGTTATTACATCCATGG
GCAATGTGCCATCATTATGTTTGATGTTACTGCCCGATTGACATACAAGA
ATGTTCCCACTTGGCACCGTGATCTTTGCCGGGTGTGTGAAAATATACCG
ATTGTTCTCTGTGGGAACAAGGTTGATGTGAAGAATAGGCAAGTCAAGGC
AAAGCAGGTTACCTTCCACAGGAAGAAGAATCTACAGTACTATGAGATTT
CTGCCAAGAGCAACTACAATTTTGAGAAACCTTTCTTGTACCTTGCCAGG
AAGCTTGCTGGGGACCCAAATTTGCACTTCGTGGAATCTCCTGCTCTCGC
TCCTCCAGAAGTACAGATTGACTTAGCTGACAGCAACACATGAAGCCGAG
CTTGCCGANCAGCTAGCCAGCC
back to top