DC900183

Overview
NameDC900183
Unique NameDC900183
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length672
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8429 contig Csv1_Contig8429:927..1598. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB35_HUMAN (Ras-related protein Rab-35 OS=Homo sapiens GN=RAB35 PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.192e-19
Identity = 53/153 (34.64%), Postives = 82/153 (53.59%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQ--VTFHRKKNLQYYEISAKSNYNFEKPF 535
            FKL+I+GD G GK++ + R     F   Y  TIGV+        N  K++   WDTAGQE+F  +   YY      I+++DVT+  ++ NV  W  ++ + C+++  +L GNK D   R+V   +    F  +  +Q +E SAK N N E+ F
Sbjct:    9 FKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMF 161          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB1A_DICDI (Ras-related protein Rab-1A OS=Dictyostelium discoideum GN=rab1A PE=2 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 1.192e-19
Identity = 56/165 (33.94%), Postives = 89/165 (53.94%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCR-VCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK------NLQYYEISAKSNYNFEKPFLYLARKL 556
            FKL+++GD G GK+  + R     + + +  TIGV+        N   I+   WDTAGQE+F  +   YY      I+++DVT +LT++NV  W +++ R  CEN+  +L GNK D+    V  K V F+  K       + + E SAK + N E+ F+ +A ++
Sbjct:    9 FKLLLIGDSGVGKSCLLLRFADDTYSESFISTIGVDFKIRTIELNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDKLTFENVRQWLQEIDRFACENVNKLLVGNKSDL----VAKKVVDFNTAKAFADSLQIPFLETSAKQSTNVEQAFMTMATEI 169          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RB11B_RAT (Ras-related protein Rab-11B OS=Rattus norvegicus GN=Rab11b PE=2 SV=4)

HSP 1 Score: 96.2857 bits (238), Expect = 1.556e-19
Identity = 55/154 (35.71%), Postives = 83/154 (53.90%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDL-CRVCENIPIVLCGNKVDVKN-RQVKAKQV-TFHRKKNLQYYEISAKSNYNFEKPF 535
            FK+V++GD G GK+  + R    EF  + + TIGVE        +   I+   WDTAGQE++  +   YY     A++++D+   LTY+NV  W ++L      NI I+L GNK D+++ R V   +   F  K NL + E SA  + N E+ F
Sbjct:   12 FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAF 165          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RB11B_MOUSE (Ras-related protein Rab-11B OS=Mus musculus GN=Rab11b PE=1 SV=3)

HSP 1 Score: 96.2857 bits (238), Expect = 1.556e-19
Identity = 55/154 (35.71%), Postives = 83/154 (53.90%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDL-CRVCENIPIVLCGNKVDVKN-RQVKAKQV-TFHRKKNLQYYEISAKSNYNFEKPF 535
            FK+V++GD G GK+  + R    EF  + + TIGVE        +   I+   WDTAGQE++  +   YY     A++++D+   LTY+NV  W ++L      NI I+L GNK D+++ R V   +   F  K NL + E SA  + N E+ F
Sbjct:   12 FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAF 165          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RB11B_HUMAN (Ras-related protein Rab-11B OS=Homo sapiens GN=RAB11B PE=1 SV=4)

HSP 1 Score: 96.2857 bits (238), Expect = 1.556e-19
Identity = 55/154 (35.71%), Postives = 83/154 (53.90%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDL-CRVCENIPIVLCGNKVDVKN-RQVKAKQV-TFHRKKNLQYYEISAKSNYNFEKPF 535
            FK+V++GD G GK+  + R    EF  + + TIGVE        +   I+   WDTAGQE++  +   YY     A++++D+   LTY+NV  W ++L      NI I+L GNK D+++ R V   +   F  K NL + E SA  + N E+ F
Sbjct:   12 FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAF 165          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RB11B_DISOM (Ras-related protein Rab-11B OS=Discopyge ommata PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.556e-19
Identity = 55/154 (35.71%), Postives = 83/154 (53.90%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDL-CRVCENIPIVLCGNKVDVKN-RQVKAKQV-TFHRKKNLQYYEISAKSNYNFEKPF 535
            FK+V++GD G GK+  + R    EF  + + TIGVE        +   I+   WDTAGQE++  +   YY     A++++D+   LTY+NV  W ++L      NI I+L GNK D+++ R V   +   F  K NL + E SA  + N E+ F
Sbjct:   12 FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAF 165          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RB11B_BOVIN (Ras-related protein Rab-11B OS=Bos taurus GN=RAB11B PE=2 SV=3)

HSP 1 Score: 96.2857 bits (238), Expect = 1.556e-19
Identity = 55/154 (35.71%), Postives = 83/154 (53.90%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDL-CRVCENIPIVLCGNKVDVKN-RQVKAKQV-TFHRKKNLQYYEISAKSNYNFEKPF 535
            FK+V++GD G GK+  + R    EF  + + TIGVE        +   I+   WDTAGQE++  +   YY     A++++D+   LTY+NV  W ++L      NI I+L GNK D+++ R V   +   F  K NL + E SA  + N E+ F
Sbjct:   12 FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAF 165          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB5C_BOVIN (Ras-related protein Rab-5C OS=Bos taurus GN=RAB5C PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.556e-19
Identity = 62/193 (32.12%), Postives = 101/193 (52.33%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCR-VCENIPIVLCGNKVDV-KNRQVKAKQVTFHRKKN-LQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLADSNT*SRA 652
            FKLV++G+   GK++ V R + G+F +  E TIG          +   ++F  WDTAGQE++  L   YY   Q AI+++D+T   T+     W ++L R    NI I L GNK D+   R V+ ++   + + N L + E SAK+  N  + F+ +A+KL  +   +   +P        +DL ++N  SR+
Sbjct:   22 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYAEDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNAAGAPG---RNRGVDLQENNPASRS 211          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB5B_CHICK (Ras-related protein Rab-5B OS=Gallus gallus GN=RAB5B PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.556e-19
Identity = 57/161 (35.40%), Postives = 88/161 (54.66%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCR-VCENIPIVLCGNKVDV-KNRQVKAKQVTFHRKKN-LQYYEISAKSNYNFEKPFLYLARKL 556
            FKLV++G+   GK++ V R + G+F +  E TIG          +   ++F  WDTAGQE++  L   YY   Q AI+++D+T + T+    TW ++L R    +I I L GNK D+   R V+ ++   +   N L + E SAK+  N    FL +A+KL
Sbjct:   21 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLASKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKL 181          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB4A_RAT (Ras-related protein Rab-4A OS=Rattus norvegicus GN=Rab4a PE=2 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 1.556e-19
Identity = 60/184 (32.61%), Postives = 100/184 (54.35%), Query Frame = 2
Query:   62 QTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVC-ENIPIVLCGNKVDV-KNRQVKAKQVT-FHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAP 604
            +T D+  FK +++G+ GTGK+  + + +  +F+     TIGVE            ++   WDTAGQE+F  +   YY     A++++D+T+R TY  +  W  D   +  +NI I+LCGNK D+  +R+V   + + F ++  L + E SA +  N E+ F+  ARK+     L+ +ES  L P
Sbjct:    3 ETYDF-LFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFMQCARKI-----LNKIESGELDP 180          
The following BLAST results are available for this feature:
BLAST of DC900183 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RAB35_HUMAN1.192e-1934.64Ras-related protein Rab-35 OS=Homo sapiens GN=RAB3... [more]
RAB1A_DICDI1.192e-1933.94Ras-related protein Rab-1A OS=Dictyostelium discoi... [more]
RB11B_RAT1.556e-1935.71Ras-related protein Rab-11B OS=Rattus norvegicus G... [more]
RB11B_MOUSE1.556e-1935.71Ras-related protein Rab-11B OS=Mus musculus GN=Rab... [more]
RB11B_HUMAN1.556e-1935.71Ras-related protein Rab-11B OS=Homo sapiens GN=RAB... [more]
RB11B_DISOM1.556e-1935.71Ras-related protein Rab-11B OS=Discopyge ommata PE... [more]
RB11B_BOVIN1.556e-1935.71Ras-related protein Rab-11B OS=Bos taurus GN=RAB11... [more]
RAB5C_BOVIN1.556e-1932.12Ras-related protein Rab-5C OS=Bos taurus GN=RAB5C ... [more]
RAB5B_CHICK1.556e-1935.40Ras-related protein Rab-5B OS=Gallus gallus GN=RAB... [more]
RAB4A_RAT1.556e-1932.61Ras-related protein Rab-4A OS=Rattus norvegicus GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900183 VSS Citrus sinensis cDNA clone VS28210 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900183 ID=DC900183|Name=DC900183|organism=Citrus sinensis|type=EST|length=672bp
CAGACCGCGAACTTCGTATTCTTTCGCACACAGTACTCAACTCATGGCTC
TGCCAAGTCAGCAAACTGTTGATTACCCGAGCTTCAAACTCGTCATAGTC
GGCGACGGTGGCACTGGGAAGACTACCTTTGTGAAGAGGCATCTGACTGG
GGAGTTTGAGAAGAAGTATGAACCAACTATTGGTGTGGAGGTTCATCCGT
TGGATTTCTTTACAAATTGTGGCAAAATCCGTTTCTACTGCTGGGACACT
GCTGGCCAGGAAAAGTTTGGTGGTCTTAGAGATGGTTATTACATCCATGG
GCAATGTGCCATCATTATGTTTGATGTTACTGCCCGATTGACATACAAGA
ATGTTCCCACTTGGCACCGTGATCTTTGCCGGGTGTGTGAAAATATACCG
ATTGTTCTCTGTGGGAACAAGGTTGATGTGAAGAATAGGCAAGTCAAGGC
AAAGCAGGTTACCTTCCACAGGAAGAAGAATCTACAGTACTATGAGATTT
CTGCCAAGAGCAACTACAATTTTGAGAAACCTTTCTTGTACCTTGCCAGG
AAGCTTGCTGGGGACCCAAATTTGCACTTCGTGGAATCTCCTGCTCTCGC
TCCTCCAGAAGTACAGATTGACTTAGCTGACAGCAACACATGAAGCCGAG
CTTGCCGANCAGCTAGCCAGCC
back to top