DC900172

Overview
NameDC900172
Unique NameDC900172
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length749
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3018 contig Csv1_Contig3018:74..822. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH_FRAAN (Alcohol dehydrogenase OS=Fragaria ananassa GN=ADH PE=3 SV=2)

HSP 1 Score: 254.218 bits (648), Expect = 5.458e-67
Identity = 117/150 (78.00%), Postives = 134/150 (89.33%), Query Frame = 1
Query:   10 TQQINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            + +  EAKK G+TEFVNPKD+  PVQ+VIA++TNGGVDRS+ECTG++QAMI AFECVHDGWGVAVLVGVP+KD  F THPMN LNERTLKGTFFGNYKPR+D+PSVVEKYMNKELEV+KFITH +PFS+INKAFD ML GE IRCII M+
Sbjct:  230 SNRFEEAKKFGITEFVNPKDHKKPVQEVIAELTNGGVDRSIECTGNIQAMIPAFECVHDGWGVAVLVGVPHKDAVFTTHPMNFLNERTLKGTFFGNYKPRTDIPSVVEKYMNKELEVDKFITHQLPFSQINKAFDYMLKGEGIRCIITME 379          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_ORYSJ (Alcohol dehydrogenase 1 OS=Oryza sativa subsp. japonica GN=ADH1 PE=2 SV=2)

HSP 1 Score: 254.218 bits (648), Expect = 5.458e-67
Identity = 120/148 (81.08%), Postives = 132/148 (89.19%), Query Frame = 1
Query:   16 QINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            +  EA+K G TEFVNPKD+D PVQQV+A+MTNGGVDRSVECTG++ AMI AFECVHDGWGVAVLVGVP+KD  FKTHPMN LNERTLKGTFFGNYKPR+DLP+VVE YM KELEVEKFITH+VPFSEIN AFDLM  GE IRCIIRM+
Sbjct:  231 RFEEARKFGCTEFVNPKDHDKPVQQVLAEMTNGGVDRSVECTGNINAMIQAFECVHDGWGVAVLVGVPHKDAEFKTHPMNFLNERTLKGTFFGNYKPRTDLPNVVELYMKKELEVEKFITHSVPFSEINTAFDLMHKGEGIRCIIRME 378          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_ORYSI (Alcohol dehydrogenase 1 OS=Oryza sativa subsp. indica GN=ADH1 PE=2 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 5.458e-67
Identity = 120/148 (81.08%), Postives = 132/148 (89.19%), Query Frame = 1
Query:   16 QINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            +  EA+K G TEFVNPKD+D PVQQV+A+MTNGGVDRSVECTG++ AMI AFECVHDGWGVAVLVGVP+KD  FKTHPMN LNERTLKGTFFGNYKPR+DLP+VVE YM KELEVEKFITH+VPFSEIN AFDLM  GE IRCIIRM+
Sbjct:  231 RFEEARKFGCTEFVNPKDHDKPVQQVLAEMTNGGVDRSVECTGNINAMIQAFECVHDGWGVAVLVGVPHKDAEFKTHPMNFLNERTLKGTFFGNYKPRTDLPNVVELYMKKELEVEKFITHSVPFSEINTAFDLMHKGEGIRCIIRME 378          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH2_MAIZE (Alcohol dehydrogenase 2 OS=Zea mays GN=ADH2 PE=2 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 1.216e-66
Identity = 117/145 (80.69%), Postives = 134/145 (92.41%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            +AKK G TEFVNPKD+D PVQ+V+ ++TNGGVDRSVECTG+V AMISAFECVHDGWGVAVLVGVP+KDD FKTHPMN L+E+TLKGTFFGNYKPR+DLP+VVE YM KELE+EKFITH+VPFSEIN AFDLML GES+RCI+RM+
Sbjct:  234 QAKKFGCTEFVNPKDHDKPVQEVLIELTNGGVDRSVECTGNVNAMISAFECVHDGWGVAVLVGVPHKDDQFKTHPMNFLSEKTLKGTFFGNYKPRTDLPNVVEMYMKKELELEKFITHSVPFSEINTAFDLMLKGESLRCIMRME 378          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_MAIZE (Alcohol dehydrogenase 1 OS=Zea mays GN=ADH1 PE=2 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 1.216e-66
Identity = 118/148 (79.73%), Postives = 133/148 (89.86%), Query Frame = 1
Query:   16 QINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            +  EA+K G TEFVNPKD++ PVQ+V+A+MTNGGVDRSVECTG++ AMI AFECVHDGWGVAVLVGVP+KD  FKTHPMN LNERTLKGTFFGNYKPR+DLP+VVE YM KELEVEKFITH+VPF+EINKAFDLM  GE IRCIIRM+
Sbjct:  231 RFEEARKFGCTEFVNPKDHNKPVQEVLAEMTNGGVDRSVECTGNINAMIQAFECVHDGWGVAVLVGVPHKDAEFKTHPMNFLNERTLKGTFFGNYKPRTDLPNVVELYMKKELEVEKFITHSVPFAEINKAFDLMAKGEGIRCIIRME 378          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH_MALDO (Alcohol dehydrogenase OS=Malus domestica GN=ADH PE=2 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 7.881e-66
Identity = 117/150 (78.00%), Postives = 134/150 (89.33%), Query Frame = 1
Query:   10 TQQINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            + +  EAKK GVTEFVNPK ++ PVQ+VIA++TN GVDRS+ECTGS +AMISAFECVHDGWGVAVLVGVP+KD  FKTHP+N LNERTLKGTFFGNYK R+D+PSVVEKYMNKELE+EKFITH VPFSEINKAF+ ML GE +RCIIRM+
Sbjct:  230 SDRFEEAKKFGVTEFVNPKAHEKPVQEVIAELTNRGVDRSIECTGSTEAMISAFECVHDGWGVAVLVGVPHKDAVFKTHPVNFLNERTLKGTFFGNYKTRTDIPSVVEKYMNKELELEKFITHKVPFSEINKAFEYMLKGEGLRCIIRME 379          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH2_ORYSJ (Alcohol dehydrogenase 2 OS=Oryza sativa subsp. japonica GN=ADH2 PE=2 SV=2)

HSP 1 Score: 247.669 bits (631), Expect = 5.109e-65
Identity = 112/148 (75.68%), Postives = 131/148 (88.51%), Query Frame = 1
Query:   16 QINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            +  +AKK G T+FVNPKD+  PV +V+ +MTNGG+DR+VECTG++ AMIS FECVHDGWGVAVLVGVP KDD FKTHPMN LNE+TLKGTFFGNYKPR+DLP+VVE YM KELE+EKFITH+VPFSEIN AFDLML GES+RC++RMD
Sbjct:  231 KFEQAKKFGCTDFVNPKDHSKPVHEVLIEMTNGGLDRAVECTGNINAMISCFECVHDGWGVAVLVGVPTKDDVFKTHPMNFLNEKTLKGTFFGNYKPRTDLPNVVELYMKKELELEKFITHSVPFSEINTAFDLMLKGESLRCVMRMD 378          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH2_ORYSI (Alcohol dehydrogenase 2 OS=Oryza sativa subsp. indica GN=ADH2 PE=2 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 5.109e-65
Identity = 112/148 (75.68%), Postives = 131/148 (88.51%), Query Frame = 1
Query:   16 QINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            +  +AKK G T+FVNPKD+  PV +V+ +MTNGG+DR+VECTG++ AMIS FECVHDGWGVAVLVGVP KDD FKTHPMN LNE+TLKGTFFGNYKPR+DLP+VVE YM KELE+EKFITH+VPFSEIN AFDLML GES+RC++RMD
Sbjct:  231 KFEQAKKFGCTDFVNPKDHSKPVHEVLIEMTNGGLDRAVECTGNINAMISCFECVHDGWGVAVLVGVPTKDDVFKTHPMNFLNEKTLKGTFFGNYKPRTDLPNVVELYMKKELELEKFITHSVPFSEINTAFDLMLKGESLRCVMRMD 378          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH3_HORVU (Alcohol dehydrogenase 3 OS=Hordeum vulgare GN=ADH3 PE=3 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 5.287e-62
Identity = 108/145 (74.48%), Postives = 126/145 (86.90%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            +AKK G T+FVNPKD+  PVQ+V+ +MTNGGVDR+VECTG + AMI+ FECVHDGWGVAVLVGVP+K+  FKTHPMN LNE+TLKGTFFGNYKPR+DLP VVE YM KEL++EKFITH+VPFS+IN AFDLML GE +RCI R D
Sbjct:  234 QAKKFGCTDFVNPKDHTKPVQEVLVEMTNGGVDRAVECTGHIDAMIATFECVHDGWGVAVLVGVPHKEAVFKTHPMNFLNEKTLKGTFFGNYKPRTDLPEVVEMYMRKELDLEKFITHSVPFSQINTAFDLMLKGEGLRCITRTD 378          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_ZEALU (Alcohol dehydrogenase 1 (Fragment) OS=Zea luxurians GN=ADH1 PE=3 SV=2)

HSP 1 Score: 234.958 bits (598), Expect = 3.427e-61
Identity = 109/135 (80.74%), Postives = 123/135 (91.11%), Query Frame = 1
Query:   16 QINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLM 420
            +  EA+K G TEFVNPKD++ PVQ+V+A+MTNGGVDRSVECTG++ AMI AFECVHDGWGVAVLVGVP+KD  FKTHPMN LNERTLKGTFFGNYKPR+DLP+VVE YM KELEVEKFITH+VPF+EINKAFDLM
Sbjct:  158 RFEEARKFGCTEFVNPKDHNKPVQEVLAEMTNGGVDRSVECTGNINAMIQAFECVHDGWGVAVLVGVPHKDAEFKTHPMNFLNERTLKGTFFGNYKPRTDLPNVVELYMKKELEVEKFITHSVPFAEINKAFDLM 292          
The following BLAST results are available for this feature:
BLAST of DC900172 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
ADH_FRAAN5.458e-6778.00Alcohol dehydrogenase OS=Fragaria ananassa GN=ADH ... [more]
ADH1_ORYSJ5.458e-6781.08Alcohol dehydrogenase 1 OS=Oryza sativa subsp. jap... [more]
ADH1_ORYSI5.458e-6781.08Alcohol dehydrogenase 1 OS=Oryza sativa subsp. ind... [more]
ADH2_MAIZE1.216e-6680.69Alcohol dehydrogenase 2 OS=Zea mays GN=ADH2 PE=2 S... [more]
ADH1_MAIZE1.216e-6679.73Alcohol dehydrogenase 1 OS=Zea mays GN=ADH1 PE=2 S... [more]
ADH_MALDO7.881e-6678.00Alcohol dehydrogenase OS=Malus domestica GN=ADH PE... [more]
ADH2_ORYSJ5.109e-6575.68Alcohol dehydrogenase 2 OS=Oryza sativa subsp. jap... [more]
ADH2_ORYSI5.109e-6575.68Alcohol dehydrogenase 2 OS=Oryza sativa subsp. ind... [more]
ADH3_HORVU5.287e-6274.48Alcohol dehydrogenase 3 OS=Hordeum vulgare GN=ADH3... [more]
ADH1_ZEALU3.427e-6180.74Alcohol dehydrogenase 1 (Fragment) OS=Zea luxurian... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900172 VSS Citrus sinensis cDNA clone VS27V94 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900172 ID=DC900172|Name=DC900172|organism=Citrus sinensis|type=EST|length=749bp
TTTGATTGAACCCAGCAGATCAATGAAGCCAAGAAGTTNGGGGTTACCGA
GTTTGTGAATCCAAAAGATTATGACAANCCTGTTCAACAGGTGATTGCTG
ACATGACCAATGGTGGAGTGGATAGAAGTGTTGAATGTACTGGAAGCGTC
CAGGCCATGATTTCAGCATTTGAATGCGTTCACGATGGTTGGGGTGTTGC
TGTGCTTGTGGGTGTGCCAAACAAAGATGATGCATTCAAGACTCATCCCA
TGAATCTGCTTAATGAGAGGACTCTTAAGGGTACCTTCTTTGGCAACTAC
AAACCTCGCTCTGATCTTCCTTCTGTTGTTGAAAAATACATGAACAAGGA
GTTGGAGGTCGAGAAATTCATCACTCACACTGTGCCCTTCTCGGAGATAA
ACAAGGCATTTGACCTCATGCTTGCGGGAGAAAGCATTAGGTGCATCATT
CGCATGGATGGTTAGATGTGTCTGCTGTTGCTGATCAATCTAATGGAGGC
AGAATGAAGATGATCACATAATTTTCCAAGTTATATATTACCCCGAGAAT
AAGTAATTTATGCTGTATGTTTGATGACTTGCTGCGAATGGCTTTCAAAG
AGTTGTGTTTTCTACATATTTCTTACAGTCCCTTTTTTTGTTTTGTTTTT
CTGTTTGATGACTTGCTGCATATGGCGTACAAAGAGGTGTGTTTTCTACC
TATTTCTTACAGTACTTCTTTTTGTAGCTTATGTAATAAAGATTTTCGT
back to top