DC900172

Overview
NameDC900172
Unique NameDC900172
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length749
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3018 contig Csv1_Contig3018:74..822. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH2_HORVU (Alcohol dehydrogenase 2 OS=Hordeum vulgare GN=ADH2 PE=3 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 6.259e-55
Identity = 99/145 (68.28%), Postives = 121/145 (83.45%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            +AKK G T+FVNPKD+  PVQ+VI +MT+GGV+R+VECTG+  AMISAFECVHDGWGVA      +K+  FKTHPMN LNERTL+GTFFGNYKPR+ LP VV+ YM KELE++KFITH++PFS+IN AFDLML GE +RC+IR +
Sbjct:  234 QAKKFGCTDFVNPKDHTKPVQEVIVEMTDGGVNRAVECTGNADAMISAFECVHDGWGVA------HKEAVFKTHPMNFLNERTLRGTFFGNYKPRTGLPGVVDMYMRKELELDKFITHSLPFSQINTAFDLMLRGEGLRCVIRSE 372          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHX_ORYSJ (Alcohol dehydrogenase class-3 OS=Oryza sativa subsp. japonica GN=Os02g0815500 PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 2.309e-41
Identity = 76/150 (50.67%), Postives = 106/150 (70.67%), Query Frame = 1
Query:   10 TQQINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            +++ + AK  GVTEFVNPKD+D P+QQVI D+T+GGVD S EC G+V  M SA EC H GWG +V+VGV        T P  L+  R  KGT FG +K RS +P +VEKY+NKE++V++++TH++  ++INKAFDL+  G  +RC++  D
Sbjct:  231 SKKFDVAKNFGVTEFVNPKDHDKPIQQVIVDLTDGGVDYSFECIGNVSVMRSALECCHKGWGTSVIVGVAASGQEISTRPFQLVTGRVWKGTAFGGFKSRSQVPWLVEKYLNKEIKVDEYVTHSMNLTDINKAFDLLHEGGCLRCVLATD 380          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHX_ORYSI (Alcohol dehydrogenase class-3 OS=Oryza sativa subsp. indica GN=ADHIII PE=3 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 2.309e-41
Identity = 76/150 (50.67%), Postives = 106/150 (70.67%), Query Frame = 1
Query:   10 TQQINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            +++ + AK  GVTEFVNPKD+D P+QQVI D+T+GGVD S EC G+V  M SA EC H GWG +V+VGV        T P  L+  R  KGT FG +K RS +P +VEKY+NKE++V++++TH++  ++INKAFDL+  G  +RC++  D
Sbjct:  231 SKKFDVAKNFGVTEFVNPKDHDKPIQQVIVDLTDGGVDYSFECIGNVSVMRSALECCHKGWGTSVIVGVAASGQEISTRPFQLVTGRVWKGTAFGGFKSRSQVPWLVEKYLNKEIKVDEYVTHSMNLTDINKAFDLLHEGGCLRCVLATD 380          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHX_ARATH (Alcohol dehydrogenase class-3 OS=Arabidopsis thaliana GN=ADH2 PE=1 SV=2)

HSP 1 Score: 166.392 bits (420), Expect = 1.497e-40
Identity = 75/147 (51.02%), Postives = 102/147 (69.39%), Query Frame = 1
Query:   10 TQQINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +++   AKK GV EFVNPKD+D P+Q+VI D+T+GGVD S EC G+V  M +A EC H GWG +V+VGV        T P  L+  R  KGT FG +K R+ +P +VEKYMNKE++V+++ITH +   EINKAFDL+  G  +RC++
Sbjct:  229 SKKYETAKKFGVNEFVNPKDHDKPIQEVIVDLTDGGVDYSFECIGNVSVMRAALECCHKGWGTSVIVGVAASGQEISTRPFQLVTGRVWKGTAFGGFKSRTQVPWLVEKYMNKEIKVDEYITHNLTLGEINKAFDLLHEGTCLRCVL 375          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHX_PEA (Alcohol dehydrogenase class-3 OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 5.688e-40
Identity = 74/147 (50.34%), Postives = 102/147 (69.39%), Query Frame = 1
Query:   10 TQQINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            + + + AK  GVTEF+NPKD++ P+QQVI D+T+GGVD S EC G+V  M SA EC H GWG +V+VGV        T P  L+  R  KGT FG +K RS +P +VEKY+ KE++V+++ITH +   EINKAFDL+  G+ +RC++
Sbjct:  228 SNKYDTAKNFGVTEFINPKDHEKPIQQVIIDLTDGGVDYSFECLGNVSVMRSALECCHKGWGTSVIVGVAASGQEISTRPFQLVTGRVWKGTAFGGFKSRSQVPWLVEKYLKKEIKVDEYITHNLTLLEINKAFDLLHEGQCLRCVL 374          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHX_SPAAU (Alcohol dehydrogenase class-3 OS=Sparus aurata PE=2 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 2.642e-37
Identity = 70/141 (49.65%), Postives = 99/141 (70.21%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            AK+ G TEFVNPKD+  P+Q+V+ +MT+GGVD S EC G+VQ M +A E  H GWG +V++GV        T P  L+  R  KGT FG +K    +P +VE YM+K+L+V++F+THT+PF +IN+ F+LM AG+SIR ++
Sbjct:  234 AKEFGATEFVNPKDHSKPIQEVLVEMTDGGVDYSFECIGNVQIMRAALEACHKGWGESVIIGVAGAGQEISTRPFQLVTGRVWKGTAFGGWKSVESVPKLVEDYMSKKLKVDEFVTHTLPFEKINEGFELMHAGKSIRTVL 374          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHL_GADMO (Alcohol dehydrogenase class-3 chain L OS=Gadus morhua PE=1 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 3.451e-37
Identity = 69/141 (48.94%), Postives = 99/141 (70.21%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            AK+ G T+ VNPKD+  PV+QV+ +MT+GGVD S EC G++  M +A E  H GWG +V++GV        T P  L+  RT KGT FG YK    +P +VE+YMNK+++V++F+THT+PF +I++ FDLM AG+SIR ++
Sbjct:  233 AKEFGATDLVNPKDHSKPVEQVLVEMTDGGVDYSFECVGNIAVMRAALEACHKGWGTSVIIGVAAAGQEISTRPFQLVTGRTWKGTAFGGYKSVESVPKLVEEYMNKKVKVDEFVTHTLPFEKIHEGFDLMGAGKSIRTVL 373          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHH_GADMO (Alcohol dehydrogenase class-3 chain H OS=Gadus morhua PE=1 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 5.886e-37
Identity = 70/146 (47.95%), Postives = 99/146 (67.81%), Query Frame = 1
Query:   13 QQINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            ++  +A + G TE +NPKD+  PVQ+V+ +MT+GGVD S EC G+V+ M SA E  H GWG +V++GV        T P  L+  R  K T FG +K    +P +VE YMNK+L+V++F+THT+PF  IN+ FDLM AG+SIRC++
Sbjct:  228 EKFGKAAEFGATECLNPKDHARPVQEVLVEMTDGGVDYSFECIGNVEIMRSALEACHKGWGESVIIGVAGAGQEIATRPFQLVTGRVWKATAFGGWKSVESVPKLVEDYMNKKLKVDEFVTHTLPFDSINEGFDLMHAGKSIRCVL 373          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHX_BOVIN (Alcohol dehydrogenase class-3 OS=Bos taurus GN=ADH5 PE=2 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.004e-36
Identity = 66/143 (46.15%), Postives = 104/143 (72.73%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRM 456
            AK+ G +E +NP+D+  P+Q+V+ +MT+GGVD S EC G+V+ M +A E  H GWG++V+VGV    +   T P  L+  RT KGT FG +K    +P +V +YM+K+++V++F+TH++PF +IN+AFDLM AG+SIR ++++
Sbjct:  232 AKEFGASECINPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGISVVVGVAASGEEIATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHSLPFDQINEAFDLMHAGKSIRTVVKL 374          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHX_MAIZE (Alcohol dehydrogenase class-3 OS=Zea mays GN=FDH PE=2 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.237e-36
Identity = 69/148 (46.62%), Postives = 100/148 (67.57%), Query Frame = 1
Query:   13 QQINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRM 456
            ++ + AK  GVTEFVNPK++D P+QQV+ D+T+GGVD S EC G+V  M +A EC   GWG +V+VGV        T P  L+  R  KGT FG +K R+ +P +V+KYM KE++V+++ITH +  ++IN AF L+  G  +RC++ M
Sbjct:  232 KKFDVAKNFGVTEFVNPKEHDKPIQQVLVDLTDGGVDYSFECIGNVSIMRAALECSDKGWGTSVIVGVAASGQEISTRPFQLVTGRVWKGTAFGGFKSRTQVPWLVDKYMKKEIKVDEYITHNMNLADINDAFHLLHEGGCLRCVLAM 379          
The following BLAST results are available for this feature:
BLAST of DC900172 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
ADH2_HORVU6.259e-5568.28Alcohol dehydrogenase 2 OS=Hordeum vulgare GN=ADH2... [more]
ADHX_ORYSJ2.309e-4150.67Alcohol dehydrogenase class-3 OS=Oryza sativa subs... [more]
ADHX_ORYSI2.309e-4150.67Alcohol dehydrogenase class-3 OS=Oryza sativa subs... [more]
ADHX_ARATH1.497e-4051.02Alcohol dehydrogenase class-3 OS=Arabidopsis thali... [more]
ADHX_PEA5.688e-4050.34Alcohol dehydrogenase class-3 OS=Pisum sativum PE=... [more]
ADHX_SPAAU2.642e-3749.65Alcohol dehydrogenase class-3 OS=Sparus aurata PE=... [more]
ADHL_GADMO3.451e-3748.94Alcohol dehydrogenase class-3 chain L OS=Gadus mor... [more]
ADHH_GADMO5.886e-3747.95Alcohol dehydrogenase class-3 chain H OS=Gadus mor... [more]
ADHX_BOVIN1.004e-3646.15Alcohol dehydrogenase class-3 OS=Bos taurus GN=ADH... [more]
ADHX_MAIZE2.237e-3646.62Alcohol dehydrogenase class-3 OS=Zea mays GN=FDH P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900172 VSS Citrus sinensis cDNA clone VS27V94 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900172 ID=DC900172|Name=DC900172|organism=Citrus sinensis|type=EST|length=749bp
TTTGATTGAACCCAGCAGATCAATGAAGCCAAGAAGTTNGGGGTTACCGA
GTTTGTGAATCCAAAAGATTATGACAANCCTGTTCAACAGGTGATTGCTG
ACATGACCAATGGTGGAGTGGATAGAAGTGTTGAATGTACTGGAAGCGTC
CAGGCCATGATTTCAGCATTTGAATGCGTTCACGATGGTTGGGGTGTTGC
TGTGCTTGTGGGTGTGCCAAACAAAGATGATGCATTCAAGACTCATCCCA
TGAATCTGCTTAATGAGAGGACTCTTAAGGGTACCTTCTTTGGCAACTAC
AAACCTCGCTCTGATCTTCCTTCTGTTGTTGAAAAATACATGAACAAGGA
GTTGGAGGTCGAGAAATTCATCACTCACACTGTGCCCTTCTCGGAGATAA
ACAAGGCATTTGACCTCATGCTTGCGGGAGAAAGCATTAGGTGCATCATT
CGCATGGATGGTTAGATGTGTCTGCTGTTGCTGATCAATCTAATGGAGGC
AGAATGAAGATGATCACATAATTTTCCAAGTTATATATTACCCCGAGAAT
AAGTAATTTATGCTGTATGTTTGATGACTTGCTGCGAATGGCTTTCAAAG
AGTTGTGTTTTCTACATATTTCTTACAGTCCCTTTTTTTGTTTTGTTTTT
CTGTTTGATGACTTGCTGCATATGGCGTACAAAGAGGTGTGTTTTCTACC
TATTTCTTACAGTACTTCTTTTTGTAGCTTATGTAATAAAGATTTTCGT
back to top