DC900172

Overview
NameDC900172
Unique NameDC900172
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length749
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3018 contig Csv1_Contig3018:74..822. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1G_HUMAN (Alcohol dehydrogenase 1C OS=Homo sapiens GN=ADH1C PE=1 SV=2)

HSP 1 Score: 129.413 bits (324), Expect = 2.028e-29
Identity = 58/142 (40.85%), Postives = 92/142 (64.79%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G TE +NP+DY  P+Q+V+ +MT+GGVD S E  G +  M+++  C H+  G +V+VGVP        +PM LL  RT KG  FG +K +  +P +V  +M K+  ++  IT+ +PF +IN+ FDL+ +G+SIR ++
Sbjct:  232 KAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQNLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNILPFEKINEGFDLLRSGKSIRTVL 373          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1A_HUMAN (Alcohol dehydrogenase 1A OS=Homo sapiens GN=ADH1A PE=1 SV=2)

HSP 1 Score: 129.028 bits (323), Expect = 2.648e-29
Identity = 59/142 (41.55%), Postives = 91/142 (64.08%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G TE +NP+DY  P+Q+V+ +MT+GGVD S E  G +  M+++  C H+  G +V+VGVP        +PM LL  RT KG   G +K +  +P +V  +M K+  ++  ITH +PF +IN+ FDL+ +G+SIR I+
Sbjct:  232 KAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQNLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTIL 373          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: FADH_PARDE (S-(hydroxymethyl)glutathione dehydrogenase OS=Paracoccus denitrificans GN=flhA PE=1 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 3.459e-29
Identity = 61/147 (41.50%), Postives = 93/147 (63.27%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTN------GGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            A+  G+T F+NPK+ +  VQ+++ ++T       GG D S +CTG+V+ M  A EC H GWG ++++GV        T P  L+  R  KGT FG  + R+D+P +V+ YM+ ++E++  ITHT+   +INK FDLM AGESIR ++
Sbjct:  228 AEHFGMTHFINPKNCENVVQEIV-NLTKTPFDQIGGADYSFDCTGNVKVMRDALECTHRGWGQSIIIGVAPAGAEISTRPFQLVTGRVWKGTAFGGARGRTDVPQIVDWYMDGKIEIDPMITHTLSLDDINKGFDLMHAGESIRSVV 373          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_GEOAT (Alcohol dehydrogenase 1 OS=Geomys attwateri GN=ADH1 PE=2 SV=3)

HSP 1 Score: 128.642 bits (322), Expect = 3.459e-29
Identity = 61/142 (42.96%), Postives = 91/142 (64.08%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G TE VNP+DYD P+ +V+ +MT+GGVD S E  G +   +SA  C  +  GV+V+VGVP    +    P  LL+ R+ KG  FG YK + D+P +V  +M K+  +E  IT+  P ++IN+ FDL+ AG+SIR ++
Sbjct:  232 KAKELGATECVNPQDYDKPIYEVLQEMTDGGVDFSFEVIGRLDTKVSALMCCQESHGVSVIVGVPPNAQSLTIDPKVLLSGRSWKGAVFGGYKGKDDVPKLVADFMAKKFPLEPLITNVFPLAKINEGFDLLRAGKSIRTVL 373          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1A_PONAB (Alcohol dehydrogenase 1A OS=Pongo abelii GN=ADH1A PE=2 SV=3)

HSP 1 Score: 128.642 bits (322), Expect = 3.459e-29
Identity = 59/142 (41.55%), Postives = 91/142 (64.08%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G TE +NP+DY+ P+Q+V+ +MT+GGVD S E  G +  M+++  C H+  G +V+VGVP        +PM LL  RT KG   G +K +  +P +V  +M K+  ++  ITH +PF +IN  FDL+ +G+SIR I+
Sbjct:  232 KAKELGATECINPQDYNKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQNLSMNPMLLLTGRTWKGAVLGGFKSKECVPKLVADFMAKKFSLDALITHVLPFEKINDGFDLLHSGKSIRTIL 373          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_CHICK (Alcohol dehydrogenase 1 OS=Gallus gallus GN=ADH1 PE=1 SV=2)

HSP 1 Score: 128.257 bits (321), Expect = 4.517e-29
Identity = 58/142 (40.85%), Postives = 91/142 (64.08%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G TE +NPKD+  P+ +V+ +MT  GVD S E  G ++ M +A    H+ +GV+V+VGVP         PM + + RT KG+ FG +K +  +P +V  YM K+  ++  ITHT+PF++IN+ FDL+  G+SIR ++
Sbjct:  233 KAKELGATECINPKDFKKPIHEVLTEMTGQGVDYSFEVIGRIETMTAALASCHNNYGVSVIVGVPPAAQKISFDPMLIFSGRTWKGSVFGGWKSKDAVPKLVADYMKKKFVLDPLITHTLPFTKINEGFDLLRTGKSIRSVL 374          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH4_HUMAN (Alcohol dehydrogenase 4 OS=Homo sapiens GN=ADH4 PE=1 SV=4)

HSP 1 Score: 127.872 bits (320), Expect = 5.899e-29
Identity = 57/147 (38.78%), Postives = 90/147 (61.22%), Query Frame = 1
Query:   10 TQQINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +++  +AK  G T+ +NP+D   P+Q+VI ++T GGVD +++C G  + M +A +C   GWG    +GV          P  L+  RT+ GTFFG +K    +P +V  Y NK+  ++  +THT+PF +I++AFDLM  G+SIR I+
Sbjct:  232 SEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGVAAGSKGLTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALVTHTLPFDKISEAFDLMNQGKSIRTIL 378          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_ANAPL (Alcohol dehydrogenase 1 (Fragment) OS=Anas platyrhynchos GN=ADH1 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 5.899e-29
Identity = 60/142 (42.25%), Postives = 91/142 (64.08%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G T+ +NPKD+  P+ +V+  MT  GVD S E  G ++ M++A    H  +GV+V+VGVP         PM L + RT KG+ FG +K +  +P +V  YM K+  ++  ITHT+PFS+IN+ FDL+ AG+SIR ++
Sbjct:   42 KAKELGATDCINPKDHKEPIHKVLIGMTGYGVDYSFEVIGRIETMVAALASCHYNYGVSVIVGVPPAAQNITFDPMLLFSGRTWKGSVFGGWKSKDSVPKLVADYMKKKFVLDPLITHTLPFSKINEGFDLLRAGKSIRSVL 183          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1G_PAPHA (Alcohol dehydrogenase 1C OS=Papio hamadryas GN=ADH1C PE=2 SV=3)

HSP 1 Score: 127.487 bits (319), Expect = 7.705e-29
Identity = 57/142 (40.14%), Postives = 92/142 (64.79%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G TE +NP+DY  P+Q+V+ +MT+GGVD S E  G +  ++++  C H+  G +V+VGVP        +P+ LL  RT KG  FG +K +  +P +V  +M K+  ++  IT+ +PF +IN+ FDL+ +G+SIR I+
Sbjct:  232 KAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTIMASLLCCHEACGTSVIVGVPPDSQNLSINPVLLLTGRTWKGAIFGGFKSKESVPKLVSDFMAKKFSLDALITNVLPFEKINEGFDLLRSGKSIRTIL 373          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_COTJA (Alcohol dehydrogenase 1 OS=Coturnix coturnix japonica GN=ADH1 PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.314e-28
Identity = 59/142 (41.55%), Postives = 89/142 (62.68%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G TE VNPKD+  P+ +V+ +MT  GVD S E  G ++ M  A    H  +GV+V+VGVP         PM + + RT KG+ FG +K +  +P +V  YM K+  ++  ITHT+PF++IN+ FDL+  G+SIR ++
Sbjct:  232 KAKELGATECVNPKDFKKPIHEVLTEMTGKGVDYSFEVIGRIETMTEALASCHYNYGVSVIVGVPPAAQKISFDPMLIFSGRTWKGSVFGGWKSKDAVPKLVADYMKKKFVLDPLITHTLPFTKINEGFDLLRTGKSIRTVL 373          
The following BLAST results are available for this feature:
BLAST of DC900172 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
ADH1G_HUMAN2.028e-2940.85Alcohol dehydrogenase 1C OS=Homo sapiens GN=ADH1C ... [more]
ADH1A_HUMAN2.648e-2941.55Alcohol dehydrogenase 1A OS=Homo sapiens GN=ADH1A ... [more]
FADH_PARDE3.459e-2941.50S-(hydroxymethyl)glutathione dehydrogenase OS=Para... [more]
ADH1_GEOAT3.459e-2942.96Alcohol dehydrogenase 1 OS=Geomys attwateri GN=ADH... [more]
ADH1A_PONAB3.459e-2941.55Alcohol dehydrogenase 1A OS=Pongo abelii GN=ADH1A ... [more]
ADH1_CHICK4.517e-2940.85Alcohol dehydrogenase 1 OS=Gallus gallus GN=ADH1 P... [more]
ADH4_HUMAN5.899e-2938.78Alcohol dehydrogenase 4 OS=Homo sapiens GN=ADH4 PE... [more]
ADH1_ANAPL5.899e-2942.25Alcohol dehydrogenase 1 (Fragment) OS=Anas platyrh... [more]
ADH1G_PAPHA7.705e-2940.14Alcohol dehydrogenase 1C OS=Papio hamadryas GN=ADH... [more]
ADH1_COTJA1.314e-2841.55Alcohol dehydrogenase 1 OS=Coturnix coturnix japon... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900172 VSS Citrus sinensis cDNA clone VS27V94 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900172 ID=DC900172|Name=DC900172|organism=Citrus sinensis|type=EST|length=749bp
TTTGATTGAACCCAGCAGATCAATGAAGCCAAGAAGTTNGGGGTTACCGA
GTTTGTGAATCCAAAAGATTATGACAANCCTGTTCAACAGGTGATTGCTG
ACATGACCAATGGTGGAGTGGATAGAAGTGTTGAATGTACTGGAAGCGTC
CAGGCCATGATTTCAGCATTTGAATGCGTTCACGATGGTTGGGGTGTTGC
TGTGCTTGTGGGTGTGCCAAACAAAGATGATGCATTCAAGACTCATCCCA
TGAATCTGCTTAATGAGAGGACTCTTAAGGGTACCTTCTTTGGCAACTAC
AAACCTCGCTCTGATCTTCCTTCTGTTGTTGAAAAATACATGAACAAGGA
GTTGGAGGTCGAGAAATTCATCACTCACACTGTGCCCTTCTCGGAGATAA
ACAAGGCATTTGACCTCATGCTTGCGGGAGAAAGCATTAGGTGCATCATT
CGCATGGATGGTTAGATGTGTCTGCTGTTGCTGATCAATCTAATGGAGGC
AGAATGAAGATGATCACATAATTTTCCAAGTTATATATTACCCCGAGAAT
AAGTAATTTATGCTGTATGTTTGATGACTTGCTGCGAATGGCTTTCAAAG
AGTTGTGTTTTCTACATATTTCTTACAGTCCCTTTTTTTGTTTTGTTTTT
CTGTTTGATGACTTGCTGCATATGGCGTACAAAGAGGTGTGTTTTCTACC
TATTTCTTACAGTACTTCTTTTTGTAGCTTATGTAATAAAGATTTTCGT
back to top