DC900172

Overview
NameDC900172
Unique NameDC900172
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length749
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3018 contig Csv1_Contig3018:74..822. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: FADH2_SCHPO (Putative S-(hydroxymethyl)glutathione dehydrogenase 2 OS=Schizosaccharomyces pombe GN=SPCC13B11.04c PE=2 SV=2)

HSP 1 Score: 126.331 bits (316), Expect = 1.716e-28
Identity = 58/143 (40.56%), Postives = 86/143 (60.14%), Query Frame = 1
Query:   22 NEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            N A   G T+F+NP D   P+Q V+   T+GG+D + +CTG+V  M SA E  H GWG ++++GV        T P  L+  R  +G  FG  K RS LP +V++Y++ +LE++K+ITH  P  EIN+AF  M  G  I+ ++
Sbjct:  235 NWAMSFGATDFINPNDLQSPIQDVLIHETDGGLDWTFDCTGNVHVMRSALEACHKGWGQSIVIGVAAAGQEISTRPFQLVTGRVWRGCAFGGVKGRSQLPDLVKEYLDHKLEIDKYITHRRPLKEINEAFTDMHNGNCIKTVL 377          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH4_RAT (Alcohol dehydrogenase 4 OS=Rattus norvegicus GN=Adh4 PE=2 SV=3)

HSP 1 Score: 126.331 bits (316), Expect = 1.716e-28
Identity = 59/147 (40.14%), Postives = 94/147 (63.95%), Query Frame = 1
Query:   10 TQQINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +++  +AK  G T+ +NP+D D PVQ VI ++T GGVD S++C G+ Q + +A +C   GWG   +VG   K D      ++++  R++KGTFFG +K    +P++V  Y NK+ +++  +TH +PF +IN A DLM  G+SIR I+
Sbjct:  231 SEKFPKAKALGATDCLNPRDLDKPVQDVITELTGGGVDFSLDCAGTAQTLKAAVDCTVVGWGSCTVVGA--KVDEMNISTVDMILGRSVKGTFFGGWKSVDSVPNLVTDYKNKKFDLDLLVTHALPFDKINDAIDLMNQGKSIRTIL 375          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_STRCA (Alcohol dehydrogenase 1 OS=Struthio camelus GN=ADH1 PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 3.824e-28
Identity = 59/142 (41.55%), Postives = 89/142 (62.68%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G T+ VNPKD+  P+ +V+ +MT  GVD S E  G  + M +A    H  +GV+V+VGVP   +     PM L + RT KG+ FG +K +  +P +V  YM K+  ++  ITHT+PF +IN+ FDL+  G+SIR ++
Sbjct:  231 KAKELGATDCVNPKDFTKPIHEVLMEMTGLGVDYSFEVIGHTETMAAALASCHFNYGVSVIVGVPPAAEKLSFDPMLLFSGRTWKGSVFGGWKSKDSVPKLVADYMEKKFVLDPLITHTLPFHKINEGFDLLRTGKSIRSVL 372          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_RABIT (Alcohol dehydrogenase 1 OS=Oryctolagus cuniculus GN=ADH1 PE=1 SV=2)

HSP 1 Score: 124.79 bits (312), Expect = 4.994e-28
Identity = 57/142 (40.14%), Postives = 92/142 (64.79%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G TE +NP+DY  P+Q+VI ++++GGVD S E  G +  +++A    H   G +V+VGVP    +   +PM LL+ RT KG  FG +K +  +P +V  +M K+  ++  IT+ +PF +IN+ FDL+ +G+SIR I+
Sbjct:  232 KAKEVGATECINPQDYKKPIQEVIQEISDGGVDFSFEVIGRLDTVVAALLSCHGACGTSVIVGVPPDSQSLTVNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFSLDPLITNVLPFEKINEGFDLLRSGKSIRTIL 373          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_APTAU (Alcohol dehydrogenase 1 OS=Apteryx australis GN=ADH1 PE=1 SV=2)

HSP 1 Score: 123.635 bits (309), Expect = 1.113e-27
Identity = 59/142 (41.55%), Postives = 89/142 (62.68%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G T+ VNPKD+  P+ +V+ +MT  GVD S E  G  + M +A    H  +GV+V++GVP   +     PM L + RT KG+ FG +K +  +P +V  YM K+  +E  ITHT+PF +IN+ FDL+  G+SIR ++
Sbjct:  232 KAKELGATDCVNPKDFTKPIHEVLMEMTGLGVDYSFEVIGHTETMAAALASCHFNYGVSVILGVPPAAEKISFDPMLLFSGRTWKGSVFGGWKSKDAVPKLVADYMEKKFVLEPLITHTLPFIKINEGFDLLRKGKSIRSVL 373          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_NAJNA (Alcohol dehydrogenase 1 OS=Naja naja PE=1 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.453e-27
Identity = 59/143 (41.26%), Postives = 88/143 (61.54%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNG-GVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G TE +NP D+  P+ +V+ D+T G GVD S E  G  + MISAF   H   G +V+VGVP        +P+ L   RT KG  FG +K +  +P +V  +M K+  ++  ITHT+PF +IN+ FDL+ +G+SIR ++
Sbjct:  231 KAKEMGATECINPLDFKKPINEVLFDLTGGEGVDYSFEVIGRTETMISAFTSCHQNLGTSVVVGVPPNASMITYNPLMLFTGRTWKGCVFGGWKSKDSVPKLVSDFMQKKFVLDPLITHTLPFEKINEGFDLLRSGKSIRTVL 373          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH4_MOUSE (Alcohol dehydrogenase 4 OS=Mus musculus GN=Adh4 PE=1 SV=3)

HSP 1 Score: 121.324 bits (303), Expect = 5.522e-27
Identity = 57/146 (39.04%), Postives = 91/146 (62.33%), Query Frame = 1
Query:   13 QQINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            ++  +AK  G T+ +NP++ D PVQ VI ++T GGVD S++C G+ Q + +A +C   GWG   +VG   K D      ++++  R++ GTFFG +K    +P++V  Y NK+ +++  +TH +PF  IN A DLM  G+SIR I+
Sbjct:  232 EKFPKAKALGATDCLNPRELDKPVQDVITELTAGGVDYSLDCAGTAQTLKAAVDCTVLGWGSCTVVGA--KVDEMTIPTVDVILGRSINGTFFGGWKSVDSVPNLVSDYKNKKFDLDLLVTHALPFESINDAIDLMKEGKSIRTIL 375          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_RANPE (Alcohol dehydrogenase 1 OS=Rana perezi PE=1 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 7.212e-27
Identity = 57/147 (38.78%), Postives = 87/147 (59.18%), Query Frame = 1
Query:   10 TQQINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            + +   AK+ G TE +NPKDY+ P+ +V+A MT+ GVD + E  G+   M SA    H G G  V+VG+          P+ +L  R L G  FG +K + D+P +V  Y+NK+ + +  ITH +PF +IN+ F+L+  G+SIR I+
Sbjct:  227 SDKFTTAKECGATECINPKDYNIPIHEVLAKMTDDGVDYAFEVIGNTTVMTSALSSSHFGCGKTVIVGLAPSSAVMSFDPLLILTGRILTGAVFGGWKSKDDVPKLVRDYLNKKFDFDPLITHYMPFEKINEGFELLRNGKSIRTIL 373          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: FADH_CANMA (S-(hydroxymethyl)glutathione dehydrogenase OS=Candida maltosa GN=FDH1 PE=3 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 9.419e-27
Identity = 61/142 (42.96%), Postives = 84/142 (59.15%), Query Frame = 1
Query:   31 KKXGVTEFVNPKDYDXPVQQV--IADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +K G T FVNP         V  + +MT+GG D + +CTG+V  M +A E  H GWG +V++GV        T P  L+  RT KG  FG  K RS LP +V  Y++ +L+VE+FITH  P + INKAF+ M AG+ IR ++
Sbjct:  237 QKLGATAFVNPTKLPEGTTIVDKLIEMTDGGCDFTFDCTGNVGVMRNALEACHKGWGTSVIIGVAAAGKEISTRPFQLVTGRTWKGAAFGGVKGRSQLPGIVNNYLDGKLKVEEFITHREPLAAINKAFEEMHAGDCIRAVV 378          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHI_RHOS4 (Alcohol dehydrogenase class-3 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=adhI PE=3 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 9.419e-27
Identity = 61/155 (39.35%), Postives = 90/155 (58.06%), Query Frame = 1
Query:   19 INEAKKX-----GVTEFVNPKDYDXPVQQVIADMTN------GGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +N AKK      G+T FVNP + D  V   + +MT       GG D + +CTG+V+ M  A E  H GWG ++++GV       +T P  L+  R  KG+ FG  + R+D+P +V+ YM  +++++  ITH +   EINK FDLM AGESIR ++
Sbjct:  220 LNNAKKEWGERFGMTHFVNPSEIDGDVVAHLVNMTKTPFDQIGGADYTFDCTGNVKVMRQALEACHRGWGQSIVIGVAPAGAEIQTRPFQLVTGRVWKGSAFGGARGRTDVPKIVDWYMEGKIQIDPMITHILSLEEINKGFDLMHAGESIRSVV 374          
The following BLAST results are available for this feature:
BLAST of DC900172 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
FADH2_SCHPO1.716e-2840.56Putative S-(hydroxymethyl)glutathione dehydrogenas... [more]
ADH4_RAT1.716e-2840.14Alcohol dehydrogenase 4 OS=Rattus norvegicus GN=Ad... [more]
ADH1_STRCA3.824e-2841.55Alcohol dehydrogenase 1 OS=Struthio camelus GN=ADH... [more]
ADH1_RABIT4.994e-2840.14Alcohol dehydrogenase 1 OS=Oryctolagus cuniculus G... [more]
ADH1_APTAU1.113e-2741.55Alcohol dehydrogenase 1 OS=Apteryx australis GN=AD... [more]
ADH1_NAJNA1.453e-2741.26Alcohol dehydrogenase 1 OS=Naja naja PE=1 SV=1[more]
ADH4_MOUSE5.522e-2739.04Alcohol dehydrogenase 4 OS=Mus musculus GN=Adh4 PE... [more]
ADH1_RANPE7.212e-2738.78Alcohol dehydrogenase 1 OS=Rana perezi PE=1 SV=1[more]
FADH_CANMA9.419e-2742.96S-(hydroxymethyl)glutathione dehydrogenase OS=Cand... [more]
ADHI_RHOS49.419e-2739.35Alcohol dehydrogenase class-3 OS=Rhodobacter sphae... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900172 VSS Citrus sinensis cDNA clone VS27V94 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900172 ID=DC900172|Name=DC900172|organism=Citrus sinensis|type=EST|length=749bp
TTTGATTGAACCCAGCAGATCAATGAAGCCAAGAAGTTNGGGGTTACCGA
GTTTGTGAATCCAAAAGATTATGACAANCCTGTTCAACAGGTGATTGCTG
ACATGACCAATGGTGGAGTGGATAGAAGTGTTGAATGTACTGGAAGCGTC
CAGGCCATGATTTCAGCATTTGAATGCGTTCACGATGGTTGGGGTGTTGC
TGTGCTTGTGGGTGTGCCAAACAAAGATGATGCATTCAAGACTCATCCCA
TGAATCTGCTTAATGAGAGGACTCTTAAGGGTACCTTCTTTGGCAACTAC
AAACCTCGCTCTGATCTTCCTTCTGTTGTTGAAAAATACATGAACAAGGA
GTTGGAGGTCGAGAAATTCATCACTCACACTGTGCCCTTCTCGGAGATAA
ACAAGGCATTTGACCTCATGCTTGCGGGAGAAAGCATTAGGTGCATCATT
CGCATGGATGGTTAGATGTGTCTGCTGTTGCTGATCAATCTAATGGAGGC
AGAATGAAGATGATCACATAATTTTCCAAGTTATATATTACCCCGAGAAT
AAGTAATTTATGCTGTATGTTTGATGACTTGCTGCGAATGGCTTTCAAAG
AGTTGTGTTTTCTACATATTTCTTACAGTCCCTTTTTTTGTTTTGTTTTT
CTGTTTGATGACTTGCTGCATATGGCGTACAAAGAGGTGTGTTTTCTACC
TATTTCTTACAGTACTTCTTTTTGTAGCTTATGTAATAAAGATTTTCGT
back to top