DC900136

Overview
NameDC900136
Unique NameDC900136
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length305
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900136 vs. ExPASy Swiss-Prot
Match: PTPLB_MOUSE (Protein-tyrosine phosphatase-like member B OS=Mus musculus GN=Ptplb PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 7.491e-11
Identity = 28/67 (41.79%), Postives = 47/67 (70.15%), Query Frame = 1
Query:    4 KLPLIYTALPYIKESETYCLRMPNKWNFSFDYFYAAILVLGFYVPGSPHMYTYMLGQRKKALSKSKK 204
            +L  IY ALP+++++  Y + +PNK+NFSFDY    IL++  Y+P  P +Y +M+ QR+K LS +++
Sbjct:  183 ELLTIYAALPFVRQAGLYSISLPNKYNFSFDYHAFLILIMISYIPLFPQLYFHMIHQRRKVLSHTEE 249          
The following BLAST results are available for this feature:
BLAST of DC900136 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
PTPLB_MOUSE7.491e-1141.79Protein-tyrosine phosphatase-like member B OS=Mus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900136 VSS Citrus sinensis cDNA clone VS27V55 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900136 ID=DC900136|Name=DC900136|organism=Citrus sinensis|type=EST|length=305bp
GTGAAGTTGCCTCTTATTTACACTGCCCTTCCATACATAAAAGAATCCGA
GACGTATTGTCTTAGAATGCCAAACAAATGGAATTTCTCTTTTGACTACT
TCTACGCTGCAATTCTTGTGCTTGGATTCTATGTGCCAGGTAGTCCTCAT
ATGTATACATATATGCTTGGGCAGAGGAAGAAAGCCCTTTCGAAATCGAA
AAAAGAGTAAAATGGTTTTTTAACTGCAATGTCTATCAGTGTATCCTATC
AAAGATCTTGATAGAACTTTTGTTTGTTTATAATAATTAACCTAACCATT
TCCTC
back to top