DC900129

Overview
NameDC900129
Unique NameDC900129
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1177
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig755 contig Csv1_Contig755:101..1276. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900129 vs. ExPASy Swiss-Prot
Match: GAL10_PACTA (Bifunctional protein GAL10 OS=Pachysolen tannophilus GN=GAL10 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 6.731e-22
Identity = 62/183 (33.88%), Postives = 94/183 (51.37%), Query Frame = 3
Query:   75 NGSMQVKITNYGAIITSLSVPDXHGNWADVVLGFDSVEPYVKGAAPFFGCIVGRVANRIKDGKFSLDGVEYTLPINK-PPNSLHGGFKGFDKVVW---EVAEYKKGENPSITFKYRSRDGEEGYPGDVSVMATYTLTSSTT---MRLDMEA----VPENKPTPISLAQHTYWNLAGHHSGEHT 590
            NG  +V I+N+GA I +  +     N   + LGFD+++ Y++   PFFG  +GRVANRI  G   ++G  Y + +N+    SLHGG  G++K  +    V   +K +  ++ F     DG EGYPGDV     YT+  +     + ++ EA          T +SL  H+YWN+    S E T
Sbjct:  371 NGKFEVSISNHGATIVAAKL-----NGIKLNLGFDNLKGYLREDNPFFGATIGRVANRISKGDLLINGTHYQVGLNELHRTSLHGGTYGYNKRTFLGPIVKTNEKEKETTMEFVLIDLDGTEGYPGDVETKVIYTVRDTGVGGELGIEYEAKLLEESGRDSTAVSLTNHSYWNIGNQPSIEGT 548          

HSP 2 Score: 26.9498 bits (58), Expect = 6.731e-22
Identity = 26/100 (26.00%), Postives = 38/100 (38.00%), Query Frame = 1
Query:  595 HSIQIWGSHITPVDQNTVPTGEIMPVKGTPFDFTTEKKIGASINEVPGLGYDHNYV------LDCGEEKSGLKHAAKLKEPSTSRVLNLWTNAPGMQFYT 876
            H   +   H+     ++ PTG+I  V  T  D     K+G       G  +D+ +V      LD   ++  L+  A    P T       T  P  QFYT
Sbjct:  549 HIKLVSNKHLESNPLDSTPTGKI--VTSTDLDSQNSAKLGPD-----GPVFDYCFVTKQQDKLDTRNDE--LRVVATATHPKTRIAFTTLTTEPAFQFYT 639          
BLAST of DC900129 vs. ExPASy Swiss-Prot
Match: GALM_STRTR (Aldose 1-epimerase OS=Streptococcus thermophilus GN=galM PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 8.872e-22
Identity = 51/166 (30.72%), Postives = 75/166 (45.18%), Query Frame = 3
Query:   72 NNGSMQVKITNYGAIITSLSVPDXHGNWADVVLGFDSVEPYVKGAAPFFGC-IVGRVANRIKDGKFSLDGVEYTLPINKPPNSLHGGFKGFDKVVWEVAEYKKGENPSITFKYRSRDGEEGYPGDVSVMATYTLTSSTTMRLDMEAVPENKPTPISLAQHTYWNLA 566
            NN  + +     GA +    VP   G   ++VLGF   E Y K       C  +GRVA RI    ++ + V Y+LP N+  N LHGG KG     W        +     F  R     +G+PGDV+V  +Y L ++  + +  EA    + T  +   H Y+NL+
Sbjct:   23 NNNGVVISTLTTGATLQEFLVPMETGALKNIVLGFSDFEDYYKNN--LCACQSIGRVAGRIGKASYTHNMVLYSLPKNEGDNCLHGGPKGMQVQNWNYVTNLNDDYVETKFIRRLYSSVDGFPGDVTVSISYRLNNNNRLTILFEAFDVTESTVFNPTNHVYFNLS 186          

HSP 2 Score: 43.5134 bits (101), Expect = 8.872e-22
Identity = 33/159 (20.75%), Postives = 66/159 (41.51%), Query Frame = 1
Query:  583 NILDHSIQIWGSHITPVDQNTVPTGEIMPVKGTPFDF--TTEKKIGASINEVPGLGYDHNYVLDCGEEKSGLKHAAKLKEPSTSRVLNLWTNAPGMQFYT---XXXXXXXXXXXXXXXXXHSGVCLETQGFPNAINQPNFPSXVVRPGESYQHTMLFEF 1044
            ++  H +QI+  +   +D   +PTG+ + V  T +DF  TT+       N     G+D  +V+  G     +K  A L +  +   + +++N  G+  +T                       + +E Q  P+A+N   F   ++  G S  + + F++
Sbjct:  190 DLSSHELQIYSDYRLELDSELIPTGQKINVDETNYDFRKTTDLLPRIEANN----GFDDAFVVG-GGTCDHVKEVAILHDKESGDGIEIFSNRNGLVIFTMDDIEDNIYFARDKGKMAKRREAIAMEAQTLPDAVNHKGFGDIILDKGHSVNYEIGFQY 343          
BLAST of DC900129 vs. ExPASy Swiss-Prot
Match: GALM_HAEIN (Aldose 1-epimerase OS=Haemophilus influenzae GN=galM PE=3 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 7.560e-20
Identity = 67/183 (36.61%), Postives = 101/183 (55.19%), Query Frame = 3
Query:   72 NNGSMQVKITNYGAIITSLSVPDXHGNWADVVLGFDSVEPYVKGAAPFFGCIVGRVANRIKDGKFSLDGVEYTLPINKPPNSLHGGFKGFDKVVWEVAEYKKGENPSITFKYRSRDGEEGYPGDVSVMATYTLTSSTTMRLDMEAVPENKPTPISLAQHTYWNLAGHHSG----EHT*PLNSN 608
            N   M+V+  ++GA   S  VP  +    +V+LG   V+ Y    + + G  VGR ANRI + +F L+G    L  N+  + LHGG +GFDK  W + E   GEN  + F   S DG++G+PG+V V  TYTLT   +++++   + + K T ++L  HTY+NL     G    EHT  LN++
Sbjct:   22 NENGMRVQFMDWGATWLSCKVP-VNDTLREVLLGC-KVDNYPTHQS-YLGASVGRYANRIANAQFELNGELIKLSSNQGKHQLHGG-EGFDKRRWNIQEC--GEN-FVCFSLHSVDGDQGFPGNVDVSVTYTLTGDNSVKIEYAGMCD-KDTALNLTNHTYFNLENAEQGSDVREHTLRLNAD 196          
BLAST of DC900129 vs. ExPASy Swiss-Prot
Match: GAL10_YEAST (Bifunctional protein GAL10 OS=Saccharomyces cerevisiae GN=GAL10 PE=1 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 2.324e-18
Identity = 53/166 (31.93%), Postives = 77/166 (46.39%), Query Frame = 3
Query:   87 QVKITNYGAIITSLSVPDXHGNWADVVLGFDSVEPYVKGAAPFFGCIVGRVANRIKDGKFSLDGVEYTLPINKPPNSLHGGFKGFDKVVWEVAEYKKGENPSITFKYRSRDGEEG--YPGDVSVMATYTLTSSTTMRLDMEAVPENK-----PTPISLAQHTYWNL 563
            Q    N GA I  L V     N   VVLG+++ E Y+   + + G  +GR ANRI  GKFSL   +Y L +N   N+ H     F +  +     +       T +Y   D E+   +PGD+ V   YT+      +  +E V + K      TPI+L  H+Y+NL
Sbjct:  385 QATFANLGASIVDLKV-----NGQSVVLGYENEEGYLNPDSAYIGATIGRYANRISKGKFSLCNKDYQLTVNNGVNANHSSIGSFHRKRFLGPIIQNPSKDVFTAEYMLIDNEKDTEFPGDLLVTIQYTV---NVAQKSLEMVYKGKLTAGEATPINLTNHSYFNL 542          

HSP 2 Score: 37.3502 bits (85), Expect = 2.324e-18
Identity = 36/147 (24.49%), Postives = 61/147 (41.50%), Query Frame = 1
Query:  631 VDQNTVPTGEIMPVKGTPFDFTTEKKIGASINEVPGLGYDHNYVLDCGEEKS-------GLKHAAKLKEPSTSRVLNLWTNAPGMQFYTXXXXXXXXXXXXXXXXXHSGVCLETQGFPNAINQPNFPSXV-VRPGESYQHTMLFEFS 1047
            VD+N +PTG I+  +   F+ T    +G    +     +D  +V+D   + S        L    K   P ++  L + +  P  QFYT                   G  +E   + +AINQ N+   V ++ GE+Y   +++ FS
Sbjct:  565 VDKNMIPTGNIVDREIATFNSTKPTVLGPKNPQ-----FDCCFVVDENAKPSQINTLNNELTLIVKAFHPDSNITLEVLSTEPTYQFYT-------GDFLSAGYEARQGFAIEPGRYIDAINQENWKDCVTLKNGETYGSKIVYRFS 699          
BLAST of DC900129 vs. ExPASy Swiss-Prot
Match: YH10_YEAST (Uncharacterized isomerase YHR210C OS=Saccharomyces cerevisiae GN=YHR210C PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 5.802e-12
Identity = 47/165 (28.48%), Postives = 79/165 (47.88%), Query Frame = 3
Query:   84 MQVKITNYGAIITSLSVPDXHGNWADVVLGFDSVEPYVKGAAPFFGCIVGRVANRIKDGKFSLDGVEYTLPINKPPNSLHGGFKGFDKVVWEVAEYKKGENPSITFKYRSRDGE---EGYPGDVSVMATYTL-TSSTTMRLDMEA-VPENKPTPISLAQHTYWNL 563
            +Q  I+  GA +  L V     N   +VLG+  +  Y+     + G  VGR ANRI  G FS++   + L +N   N+ H     F    ++ ++ +   +     ++   D       +PGD++V   YTL  +  T+ L+ EA +   + TPI++  HTY+NL
Sbjct:   21 LQATISELGATLLDLKV-----NNESIVLGYPDIHGYISDGYNYIGATVGRYANRIYKGMFSMEDGPHQLTVNNCGNTNHSSISSFHLKKYKASKVQNPLDDLYIVEFTLLDDRTLPNEFPGDLAVNLKYTLNVADMTLDLEYEAKLVSGEATPINMTNHTYFNL 180          
The following BLAST results are available for this feature:
BLAST of DC900129 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
GAL10_PACTA6.731e-2233.88Bifunctional protein GAL10 OS=Pachysolen tannophil... [more]
GALM_STRTR8.872e-2230.72Aldose 1-epimerase OS=Streptococcus thermophilus G... [more]
GALM_HAEIN7.560e-2036.61Aldose 1-epimerase OS=Haemophilus influenzae GN=ga... [more]
GAL10_YEAST2.324e-1831.93Bifunctional protein GAL10 OS=Saccharomyces cerevi... [more]
YH10_YEAST5.802e-1228.48Uncharacterized isomerase YHR210C OS=Saccharomyces... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900129 VSS Citrus sinensis cDNA clone VS27V46 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900129 ID=DC900129|Name=DC900129|organism=Citrus sinensis|type=EST|length=1177bp
ATTAGTACTCAAATTTCACAACAAAGAGAAAAATGGCTGATCATACATTA
AAACCAGAAGTGTTTGAACTGAACAATGGAAGCATGCAAGTCAAAATTAC
CAATTATGGAGCCATTATCACCTCACTTTCTGTACCTGACANACATGGAA
ATTGGGCTGACGTTGTTCTTGGATTCGACTCTGTCGAACCATACGTGAAA
GGTGCTGCACCTTTTTTTGGCTGCATTGTGGGTAGGGTTGCTAACAGAAT
TAAAGATGGGAAGTTTTCTCTCGACGGGGTTGAATACACTTTGCCCATCA
ACAAGCCACCAAACAGTCTCCATGGTGGGTTCAAGGGTTTTGATAAAGTT
GTCTGGGAGGTAGCAGAATATAAGAAAGGTGAAAACCCTTCCATTACTTT
CAAGTATCGCAGCCGTGATGGCGAGGAAGGTTACCCAGGGGATGTTTCTG
TGATGGCAACCTACACACTAACATCAAGCACGACAATGAGGCTTGACATG
GAAGCAGTTCCAGAAAACAAGCCGACCCCAATCAGTTTAGCTCAACACAC
GTACTGGAACTTAGCAGGCCATCATTCAGGGGAACATACTTGACCACTCA
ATTCAAATATGGGGATCACACATTACTCCTGTAGATCAGAACACGGTCCC
AACTGGAGAAATTATGCCAGTCAAGGGCACCCCTTTTGATTTCACCACTG
AGAAAAAGATTGGTGCATCAATCAATGAAGTACCTGGTTTAGGGTATGAT
CACAACTATGTTCTTGATTGTGGAGAAGAGAAATCAGGTCTGAAACATGC
TGCAAAACTGAAGGAACCATCAACCTCAAGGGTCCTTAATTTATGGACCA
ATGCCCCAGGCATGCAGTTTTACACTGGTAACTATGTTAACGGAGTTGTT
GGAAAGGGGGGTGCAGTTTATGGAAAGCACTCAGGTGTCTGCTTGGAGAC
GCAGGGGTTTCCTAACGCCATAAATCAACCTAACTTCCCTTCTGNTGTGG
TTCGACCCGGTGAGAGCTACCAACATACTATGTTGTTTGAGTTTTCAGTT
GAGTGAACTATTAGTCTCTTGAAGAGTAGTTCTTGGAATAAGGTTATTGT
TCATGGGTTTGCATACCATGGCGAGTACTGATGTTTGGATGTTGGCTAAA
TCTAAATAATAAAATAATATTATAAGA
back to top