DC900117

Overview
NameDC900117
Unique NameDC900117
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length641
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8536 contig Csv1_Contig8536:33..673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_ASHGO (60S ribosomal protein L3 OS=Ashbya gossypii GN=RPL3 PE=3 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 1.794e-54
Identity = 101/149 (67.79%), Postives = 120/149 (80.54%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLK 449
            +LPRKTHRGLRKVACIGAWHPA V +TVARAGQNGYHHRT +N K+Y++GK   E ++A TEFDRT+K ITPMGGF HYG VN D++++KG   G +KRVVTLR+SL   TSR ALEE+ LK+IDT+SKFG GRFQT  EK  + G LK
Sbjct:  238 KLPRKTHRGLRKVACIGAWHPAHVMWTVARAGQNGYHHRTSINHKVYRIGKGGDEGNAA-TEFDRTKKTITPMGGFVHYGAVNNDFVMVKGSIPGTRKRVVTLRKSLYTSTSRRALEEVNLKWIDTASKFGKGRFQTPAEKHAFMGTLK 385          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_HUMAN (60S ribosomal protein L3 OS=Homo sapiens GN=RPL3 PE=1 SV=2)

HSP 1 Score: 211.846 bits (538), Expect = 2.344e-54
Identity = 101/155 (65.16%), Postives = 124/155 (80.00%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKA------SQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLK 449
            +LPRKTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKKIYK+G+           ++A T++D ++K I P+GGF HYG V  D++++KGC VG KKRV+TLR+SLL QT R ALE+I LKFIDT+SKFGHGRFQT +EK  + G LK
Sbjct:  239 KLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLK 393          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3L_BOVIN (60S ribosomal protein L3-like OS=Bos taurus GN=RPL3L PE=2 SV=3)

HSP 1 Score: 210.69 bits (535), Expect = 5.221e-54
Identity = 99/155 (63.87%), Postives = 121/155 (78.06%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQES------HSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLK 449
            +LPRKTH+GLRKVACIGAWHPARV  ++ARAGQ GYHHRTE+NKKIY++G+           ++A T +D T+K ITP+GGFPHYG VN D++++KGC  G KKRV+TLR+SLL   SR ALE I+LKFIDT+SKFGHGRFQT QEK  + G  K
Sbjct:  239 KLPRKTHKGLRKVACIGAWHPARVGCSIARAGQKGYHHRTELNKKIYRIGRGLHMEDGKVVKNNASTSYDVTDKSITPLGGFPHYGEVNNDFVMLKGCIAGTKKRVITLRKSLLVHHSRQALENIELKFIDTTSKFGHGRFQTAQEKRAFMGPQK 393          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_DICDI (60S ribosomal protein L3 OS=Dictyostelium discoideum GN=rpl3 PE=1 SV=2)

HSP 1 Score: 207.994 bits (528), Expect = 3.384e-53
Identity = 98/154 (63.64%), Postives = 119/154 (77.27%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQES----HSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLKA 452
            +LPRKTH+GLRKVACIGAWHP+RVS TV RAGQ GYHHR E NKKIY++G+A  E      +  TEFD TEK I PMGGF HYG+V  ++L++KGC  GP+KR +TLR+S+  QT R ALE+I LKFIDTSSKFGHG  QT ++K KY+G  K+
Sbjct:  240 KLPRKTHKGLRKVACIGAWHPSRVSTTVPRAGQLGYHHRVERNKKIYRIGQAQPEDGKQISTGKTEFDLTEKTINPMGGFAHYGMVKHEFLMLKGCVAGPRKRALTLRKSITTQTGRAALEKITLKFIDTSSKFGHGLHQTAEDKTKYFGVKKS 393          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_KLULA (60S ribosomal protein L3 OS=Kluyveromyces lactis GN=RPL3 PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 5.773e-53
Identity = 98/149 (65.77%), Postives = 120/149 (80.54%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLK 449
            +LPRKTHRGLRKVACIGAWHPA V ++VARAGQ GYHHRT +N K+Y++GK   E+++A TEFDRT+K ITPMGGF HYG +N D++++KG   G +KRVVTLR+SL   TSR ALEE+ LK+IDT+SKFG GRFQT  EK  + G LK
Sbjct:  237 KLPRKTHRGLRKVACIGAWHPAHVMWSVARAGQRGYHHRTSINHKVYRVGKGDDEANAA-TEFDRTKKTITPMGGFVHYGAINNDFVILKGSIPGTRKRVVTLRKSLYTNTSRKALEEVTLKWIDTASKFGKGRFQTPAEKHAFLGTLK 384          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3L_HUMAN (60S ribosomal protein L3-like OS=Homo sapiens GN=RPL3L PE=1 SV=3)

HSP 1 Score: 207.223 bits (526), Expect = 5.773e-53
Identity = 97/155 (62.58%), Postives = 120/155 (77.42%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQES------HSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLK 449
            +LPRKTH+GLRKVACIGAWHPARV  ++ARAGQ GYHHRTE+NKKI+++G+           ++A T +D T K ITP+GGFPHYG VN D++++KGC  G KKRV+TLR+SLL   SR A+E I+LKFIDT+SKFGHGRFQT QEK  + G  K
Sbjct:  239 KLPRKTHKGLRKVACIGAWHPARVGCSIARAGQKGYHHRTELNKKIFRIGRGPHMEDGKLVKNNASTSYDVTAKSITPLGGFPHYGEVNNDFVMLKGCIAGTKKRVITLRKSLLVHHSRQAVENIELKFIDTTSKFGHGRFQTAQEKRAFMGPQK 393          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_MACFA (60S ribosomal protein L3 OS=Macaca fascicularis GN=RPL3 PE=2 SV=3)

HSP 1 Score: 206.453 bits (524), Expect = 9.847e-53
Identity = 100/155 (64.52%), Postives = 123/155 (79.35%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKA------SQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLK 449
            +LPRKTHRGLRKVACIGA HPARV+F+VARAGQ GYHHRTE+NKKIYK+G+           ++A T++D ++K I P+GGF HYG V  D++++KGC VG KKRV+TLR+SLL QT R ALE+I LKFIDT+SKFGHGRFQT +EK  + G LK
Sbjct:  239 KLPRKTHRGLRKVACIGARHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLK 393          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_CANGA (60S ribosomal protein L3 OS=Candida glabrata GN=RPL3 PE=3 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 4.887e-52
Identity = 98/149 (65.77%), Postives = 118/149 (79.19%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLK 449
            +LPRKTHRGLRKVACIGAWHPA V ++VARAGQ GYHHRT +N KIY++GK   E ++A T FDRT+K I PMGGF HYG+VN D++++KG   G KKRVVTLR+SL   TSR A+EE+ LK+IDT+SKFG GRFQT  EK  + G LK
Sbjct:  237 KLPRKTHRGLRKVACIGAWHPAHVMWSVARAGQRGYHHRTSINHKIYRIGKGDDEGNAA-TNFDRTKKTINPMGGFVHYGMVNNDFVMVKGSIPGCKKRVVTLRKSLYTNTSRKAVEEVTLKWIDTASKFGKGRFQTPAEKHAFMGTLK 384          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_YEAST (60S ribosomal protein L3 OS=Saccharomyces cerevisiae GN=RPL3 PE=1 SV=4)

HSP 1 Score: 202.986 bits (515), Expect = 1.089e-51
Identity = 96/149 (64.43%), Postives = 117/149 (78.52%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLK 449
            +LPRKTHRGLRKVACIGAWHPA V ++VARAGQ GYH RT +N KIY++GK   E++ A T FDRT+K ITPMGGF HYG +  D++++KGC  G +KR+VTLR+SL   TSR ALEE+ LK+IDT+SKFG GRFQT  EK  + G LK
Sbjct:  237 KLPRKTHRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGA-TSFDRTKKTITPMGGFVHYGEIKNDFIMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLK 384          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3B_SCHPO (60S ribosomal protein L3-B OS=Schizosaccharomyces pombe GN=rpl3b PE=2 SV=2)

HSP 1 Score: 198.749 bits (504), Expect = 2.053e-50
Identity = 96/149 (64.43%), Postives = 116/149 (77.85%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLK 449
            RLPRKTHRGLRKVACIGAWHPA V +TVARAG  GY HRT++N KIY++G A  ++ +A T+FD TEK ITPMGGF  YGVV  D++++ G   GP KRV+TLR+SLL  TSR ALE + LK+IDT+SKFGHGRFQT  E  ++ G LK
Sbjct:  237 RLPRKTHRGLRKVACIGAWHPANVQWTVARAGNAGYMHRTQLNSKIYRIG-AGDDAKNASTDFDATEKRITPMGGFVRYGVVENDFVMLNGATPGPVKRVLTLRKSLLTHTSRKALEPVSLKWIDTASKFGHGRFQTPAEAKQFLGTLK 384          
The following BLAST results are available for this feature:
BLAST of DC900117 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 72
Match NameE-valueIdentityDescription
RL3_ASHGO1.794e-5467.7960S ribosomal protein L3 OS=Ashbya gossypii GN=RPL... [more]
RL3_HUMAN2.344e-5465.1660S ribosomal protein L3 OS=Homo sapiens GN=RPL3 P... [more]
RL3L_BOVIN5.221e-5463.8760S ribosomal protein L3-like OS=Bos taurus GN=RPL... [more]
RL3_DICDI3.384e-5363.6460S ribosomal protein L3 OS=Dictyostelium discoide... [more]
RL3_KLULA5.773e-5365.7760S ribosomal protein L3 OS=Kluyveromyces lactis G... [more]
RL3L_HUMAN5.773e-5362.5860S ribosomal protein L3-like OS=Homo sapiens GN=R... [more]
RL3_MACFA9.847e-5364.5260S ribosomal protein L3 OS=Macaca fascicularis GN... [more]
RL3_CANGA4.887e-5265.7760S ribosomal protein L3 OS=Candida glabrata GN=RP... [more]
RL3_YEAST1.089e-5164.4360S ribosomal protein L3 OS=Saccharomyces cerevisi... [more]
RL3B_SCHPO2.053e-5064.4360S ribosomal protein L3-B OS=Schizosaccharomyces ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900117 VSS Citrus sinensis cDNA clone VS27V32 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900117 ID=DC900117|Name=DC900117|organism=Citrus sinensis|type=EST|length=641bp
CTCGTCTCCCTCGTAAGACTCACCGTGGTCTACGCAAGGTTGCTTGTATT
GGTGCCTGGCATCCGGCTAGGGTCTCCTTTACCGTTGCTAGAGCTGGGCA
GAACGGCTACCATCACCGTACAGAGATGAACAAGAAAATTTACAAGCTTG
GGAAGGCCAGCCAGGAGTCTCATTCTGCCATGACTGAATTTGACAGGACG
GAGAAGGATATCACCCCAATGGGAGGCTTCCCCCACTATGGTGTAGTCAA
TGAAGATTACCTGCTGATCAAGGGCTGCTGTGTTGGACCTAAGAAGCGTG
TTGTGACGTTAAGGCAGTCCCTACTGAAGCAGACGTCTAGGCTTGCATTG
GAGGAGATTAAGCTCAAGTTCATTGACACATCCTCCAAGTTCGGCCATGG
TCGGTTCCAGACAACGCAGGAGAAGGCCAAGTACTATGGAAGGCTCAAGG
CTTGATTTTGGCCAAGTTGAAGAAGAGATTGCCTTTGGTTTCAGGGTAGT
TTTGAACATCTAAGATTTTTGGTCATTCTAGTCTCTATTTTGAATTAATA
TGGCTATGGCTACACTGGCAGTTCTTGGAAACTTCATTTGTGCATGGTTT
GTTTTTTGCGCGTTAATACATCTTACGGTATTTTTGGGCTT
back to top