DC900117

Overview
NameDC900117
Unique NameDC900117
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length641
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8536 contig Csv1_Contig8536:33..673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3A_SCHPO (60S ribosomal protein L3-A OS=Schizosaccharomyces pombe GN=rpl3a PE=1 SV=2)

HSP 1 Score: 198.749 bits (504), Expect = 2.053e-50
Identity = 96/149 (64.43%), Postives = 116/149 (77.85%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLK 449
            RLPRKTHRGLRKVACIGAWHPA V +TVARAG  GY HRT++N KIY++G A  ++ +A T+FD TEK ITPMGGF  YGVV  D++++ G   GP KRV+TLR+SLL  TSR ALE + LK+IDT+SKFGHGRFQT  E  ++ G LK
Sbjct:  237 RLPRKTHRGLRKVACIGAWHPANVQWTVARAGNAGYMHRTQLNSKIYRIG-AGDDAKNASTDFDATEKRITPMGGFVRYGVVENDFVMLNGATPGPVKRVLTLRKSLLTHTSRKALEPVSLKWIDTASKFGHGRFQTPAEAKQFLGTLK 384          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_DEBHA (60S ribosomal protein L3 OS=Debaryomyces hansenii GN=RPL3 PE=3 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 2.681e-50
Identity = 96/149 (64.43%), Postives = 114/149 (76.51%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLK 449
            +LPRKTHRGLRKVACIGAWHPA V +TVARAGQNG+HHRT +N K+Y++G A  ES  A TEFDRT+K I PMGGF  YG V  D++L+KG   G KKR+VT+R+SL   TSR A E + LK+IDT+SKFG GRFQT  EK  + G LK
Sbjct:  237 KLPRKTHRGLRKVACIGAWHPANVQWTVARAGQNGFHHRTSINHKVYRVGSAGDESSGA-TEFDRTKKTINPMGGFVRYGNVKNDFMLLKGSIPGVKKRIVTIRKSLYVDTSRRATENVNLKWIDTASKFGKGRFQTPAEKHAFLGTLK 384          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_NEUCR (60S ribosomal protein L3 OS=Neurospora crassa GN=rpl-3 PE=3 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 5.974e-50
Identity = 94/149 (63.09%), Postives = 117/149 (78.52%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLK 449
            +LPRKTH+GLRKVACIGAWHP+ V +TVARAGQ GYHHRT +N KIY++GK   E  SA TE D T+K ITPMGGF  YG +N D++++KG   G KKRV+TLR+S+   TSR ALE+++LK+IDTSS+FGHG FQT  EK ++ G LK
Sbjct:  238 KLPRKTHKGLRKVACIGAWHPSHVQWTVARAGQAGYHHRTSVNHKIYRIGKGDAED-SAATEVDVTKKKITPMGGFVRYGEINNDFVMVKGSVPGVKKRVMTLRKSMFVHTSRKALEKVELKWIDTSSEFGHGAFQTPAEKKQFQGTLK 385          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_ASPFU (60S ribosomal protein L3 OS=Aspergillus fumigatus GN=rpl3 PE=1 SV=2)

HSP 1 Score: 197.208 bits (500), Expect = 5.974e-50
Identity = 93/149 (62.42%), Postives = 117/149 (78.52%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLK 449
            +LPRKTH+GLRKVACIGAWHP+ V +TVARAGQ GYHHRT  N K++++GK S E + A T+FD ++K ITPMGGF  YG V  DY+++KG   G KKRV+TLR++L  QTSR A E+++LK+IDTSSKFGHG FQT +EK  + G LK
Sbjct:  238 KLPRKTHKGLRKVACIGAWHPSHVQWTVARAGQMGYHHRTSCNHKVFRIGKGSDEGN-ASTDFDISKKQITPMGGFVRYGEVKNDYIMVKGSVPGVKKRVMTLRKTLYPQTSRRATEKVELKWIDTSSKFGHGAFQTPEEKRAFMGTLK 385          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_ENCCU (60S ribosomal protein L3 OS=Encephalitozoon cuniculi GN=RPL3-1 PE=1 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 2.775e-47
Identity = 89/148 (60.14%), Postives = 114/148 (77.03%), Query Frame = 3
Query:    9 PRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLKA 452
            PRK+ +G+RKVACIGAWHP+RV +++ARAGQ G+H RTE NK++Y +G  S    +  TEFD TEK I+PMGGFPHYG V  D++++KG  VG +KRVVTLR+SLL+Q    A EE+ +KF+DTSSK GHGRFQT+ EK  +YG  KA
Sbjct:  235 PRKSRKGIRKVACIGAWHPSRVMYSIARAGQMGFHRRTEKNKRVYMIGNGSS---NIKTEFDLTEKPISPMGGFPHYGEVRNDFIMVKGAVVGARKRVVTLRKSLLRQR---AGEELVIKFVDTSSKIGHGRFQTSAEKKAFYGARKA 376          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_PIG (60S ribosomal protein L3 (Fragment) OS=Sus scrofa GN=RPL3 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.870e-27
Identity = 55/95 (57.89%), Postives = 72/95 (75.79%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGK------ASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLI 269
            +LPRKTHRGLRKVACIGAWHPAR +F+VARAGQ GYHHRTE+NKKIYK+G+           ++  T++D ++K I P+G F HYG V  D++++
Sbjct:   36 KLPRKTHRGLRKVACIGAWHPARXAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNXXTDYDLSDKSINPLGRFVHYGEVTNDFVML 130          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_THESM (50S ribosomal protein L3P OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 3.649e-23
Identity = 53/125 (42.40%), Postives = 76/125 (60.80%), Query Frame = 3
Query:   15 KTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSK 389
            K  +G RKVA IG WHPARV +TV RAGQ G+HHRTE NK++ ++G+      +     +  + +ITP GGFPHYGVV  D+++I G   G  KR++ +R ++     R   E  ++ +I   SK
Sbjct:  240 KDSKGRRKVATIGPWHPARVMWTVPRAGQMGFHHRTEFNKRLLRIGE------NGKLTLNGEKIEITPNGGFPHYGVVKNDFIMIAGTIPGAIKRIIRMRPAVRPPAKRPPAEAPQITYISRESK 358          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_PYRFU (50S ribosomal protein L3P OS=Pyrococcus furiosus GN=rpl3p PE=3 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.062e-22
Identity = 49/125 (39.20%), Postives = 77/125 (61.60%), Query Frame = 3
Query:   15 KTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSK 389
            K  +G RKV  IG WHPARV +TV  AGQ G+HHRTE+NK++  +G+     +  +   + TE +ITP GGFPHYG+V  D+++I G   G  KR++ +R ++     +  ++  ++ ++   SK
Sbjct:  245 KDSKGRRKVGSIGPWHPARVMWTVPMAGQMGFHHRTELNKRLIAIGE-----NGKLKLDENTEIEITPKGGFPHYGIVRSDFMMIAGSVPGAIKRIIRVRPAIRPPKKKPPVQRPQITYVSVESK 364          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_PYRAB (50S ribosomal protein L3P OS=Pyrococcus abyssi GN=rpl3p PE=3 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.811e-22
Identity = 49/125 (39.20%), Postives = 75/125 (60.00%), Query Frame = 3
Query:   15 KTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSK 389
            K  +G RKV  IG WHPARV +TV  AGQ G+HHRTE+NK++  +G+      +     D  E +ITP GGFPHYG+V  D+++I G   G  KR++ +R ++     +  ++  ++ ++   SK
Sbjct:  242 KDSKGRRKVGSIGPWHPARVMWTVPMAGQMGFHHRTELNKRLIAIGE------NGKLVIDGNEIEITPKGGFPHYGIVRSDFMMIAGSVPGAIKRIIRVRPAIRPPKKKPPVQRPQITYVSVESK 360          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_PYRHO (50S ribosomal protein L3P OS=Pyrococcus horikoshii GN=rpl3p PE=3 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 3.089e-22
Identity = 49/125 (39.20%), Postives = 75/125 (60.00%), Query Frame = 3
Query:   15 KTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSK 389
            K  +G RKV  IG WHPARV +TV  AGQ G+HHRTE+NK++  +G+      +     D  E +ITP GGFPHYG+V  D+++I G   G  KR++ +R ++     +  ++  ++ ++   SK
Sbjct:  243 KDSKGRRKVGSIGPWHPARVMWTVPMAGQMGFHHRTELNKRLIAIGE------NGKLVIDGNEIEITPKGGFPHYGIVRGDFMMIAGSVPGAIKRIIRVRPAIRPPKKKPPVQRPQITYVSVESK 361          
The following BLAST results are available for this feature:
BLAST of DC900117 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 72
Match NameE-valueIdentityDescription
RL3A_SCHPO2.053e-5064.4360S ribosomal protein L3-A OS=Schizosaccharomyces ... [more]
RL3_DEBHA2.681e-5064.4360S ribosomal protein L3 OS=Debaryomyces hansenii ... [more]
RL3_NEUCR5.974e-5063.0960S ribosomal protein L3 OS=Neurospora crassa GN=r... [more]
RL3_ASPFU5.974e-5062.4260S ribosomal protein L3 OS=Aspergillus fumigatus ... [more]
RL3_ENCCU2.775e-4760.1460S ribosomal protein L3 OS=Encephalitozoon cunicu... [more]
RL3_PIG1.870e-2757.8960S ribosomal protein L3 (Fragment) OS=Sus scrofa ... [more]
RL3_THESM3.649e-2342.4050S ribosomal protein L3P OS=Thermococcus sibiricu... [more]
RL3_PYRFU1.062e-2239.2050S ribosomal protein L3P OS=Pyrococcus furiosus G... [more]
RL3_PYRAB1.811e-2239.2050S ribosomal protein L3P OS=Pyrococcus abyssi GN=... [more]
RL3_PYRHO3.089e-2239.2050S ribosomal protein L3P OS=Pyrococcus horikoshii... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900117 VSS Citrus sinensis cDNA clone VS27V32 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900117 ID=DC900117|Name=DC900117|organism=Citrus sinensis|type=EST|length=641bp
CTCGTCTCCCTCGTAAGACTCACCGTGGTCTACGCAAGGTTGCTTGTATT
GGTGCCTGGCATCCGGCTAGGGTCTCCTTTACCGTTGCTAGAGCTGGGCA
GAACGGCTACCATCACCGTACAGAGATGAACAAGAAAATTTACAAGCTTG
GGAAGGCCAGCCAGGAGTCTCATTCTGCCATGACTGAATTTGACAGGACG
GAGAAGGATATCACCCCAATGGGAGGCTTCCCCCACTATGGTGTAGTCAA
TGAAGATTACCTGCTGATCAAGGGCTGCTGTGTTGGACCTAAGAAGCGTG
TTGTGACGTTAAGGCAGTCCCTACTGAAGCAGACGTCTAGGCTTGCATTG
GAGGAGATTAAGCTCAAGTTCATTGACACATCCTCCAAGTTCGGCCATGG
TCGGTTCCAGACAACGCAGGAGAAGGCCAAGTACTATGGAAGGCTCAAGG
CTTGATTTTGGCCAAGTTGAAGAAGAGATTGCCTTTGGTTTCAGGGTAGT
TTTGAACATCTAAGATTTTTGGTCATTCTAGTCTCTATTTTGAATTAATA
TGGCTATGGCTACACTGGCAGTTCTTGGAAACTTCATTTGTGCATGGTTT
GTTTTTTGCGCGTTAATACATCTTACGGTATTTTTGGGCTT
back to top