DC900117

Overview
NameDC900117
Unique NameDC900117
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length641
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8536 contig Csv1_Contig8536:33..673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_METST (50S ribosomal protein L3P OS=Methanosphaera stadtmanae (strain DSM 3091) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.754e-17
Identity = 52/122 (42.62%), Postives = 67/122 (54.92%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKD-ITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFG 395
            R V  IG W P R  +TVA  GQ GYH RTE NKK+ K+G             D +E D I P GGF  YG V  +Y+L+KG   GP KR+V LR+ +   + ++   EI   +I T+SK G
Sbjct:  230 RHVGSIGPWTPNRTMWTVAMQGQMGYHKRTEYNKKLLKIG-------------DESEVDLINPDGGFVKYGFVKNNYILVKGSLPGPSKRLVVLRKGVRNASKQVTAPEI--SYISTTSKQG 336          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_METMA (50S ribosomal protein L3P OS=Methanosarcina mazei GN=rpl3p PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.754e-17
Identity = 48/122 (39.34%), Postives = 71/122 (58.20%), Query Frame = 3
Query:   30 LRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFG 395
            LR++  +G+++P+RVS+ V + GQ GYH RTE NK+I K+G   +E              +TP GGF +YG+V  DY+LIKG   GP KR++ LR  +  +  +  L E  + +I   SK G
Sbjct:  232 LRQIGTLGSFNPSRVSWRVPQMGQMGYHQRTEFNKRILKIGSDGEE--------------VTPEGGFINYGLVRGDYVLIKGSVPGPSKRLIRLRDPI--RAKKADLGEPNILYISRESKQG 337          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_METMP (50S ribosomal protein L3P OS=Methanococcus maripaludis GN=rpl3p PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 3.908e-17
Identity = 51/122 (41.80%), Postives = 63/122 (51.64%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGH 398
            R    IG W P RV +TV   GQ G+H RTE NK+I KLG    E              ITP GGF +YG V   Y+++KG   GP KR+V LR S+     +  L EI   +I T SK G+
Sbjct:  229 RHTGSIGPWRPRRVMWTVPLPGQMGFHQRTEYNKRILKLGSEGAE--------------ITPKGGFLNYGAVKNGYVVVKGTVQGPAKRLVVLRGSVRAAEDKFGLPEI--AYISTESKQGN 334          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_METM7 (50S ribosomal protein L3P OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 5.104e-17
Identity = 50/122 (40.98%), Postives = 63/122 (51.64%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGH 398
            R    IG W P RV +TV   GQ G+H RTE NK+I KLG    E              ITP GGF +YG V   Y+++KG   GP KR+V LR S+     +  L E+   +I T SK G+
Sbjct:  229 RHTGSIGPWRPRRVMWTVPLPGQMGFHQRTEYNKRILKLGSEGAE--------------ITPKGGFLNYGAVKNGYVVVKGTVQGPAKRLVVLRGSVRAAEDKFGLPEV--AYISTESKQGN 334          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_METM6 (50S ribosomal protein L3P OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 5.104e-17
Identity = 50/122 (40.98%), Postives = 63/122 (51.64%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGH 398
            R    IG W P RV +TV   GQ G+H RTE NK+I KLG    E              ITP GGF +YG V   Y+++KG   GP KR+V LR S+     +  L E+   +I T SK G+
Sbjct:  229 RHTGSIGPWRPRRVMWTVPLPGQMGFHQRTEYNKRILKLGSEGAE--------------ITPKGGFLNYGAVKNGYVVVKGTVQGPAKRLVVLRGSVRAAEDKFGLPEV--AYISTESKQGN 334          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_METM5 (50S ribosomal protein L3P OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 5.104e-17
Identity = 50/122 (40.98%), Postives = 63/122 (51.64%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGH 398
            R    IG W P RV +TV   GQ G+H RTE NK+I KLG    E              ITP GGF +YG V   Y+++KG   GP KR+V LR S+     +  L E+   +I T SK G+
Sbjct:  229 RHTGSIGPWRPRRVMWTVPLPGQMGFHQRTEYNKRILKLGSEGAE--------------ITPKGGFLNYGAVKNGYVVVKGTVQGPAKRLVVLRGSVRAAEDKFGLPEV--AYISTESKQGN 334          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_ARCFU (50S ribosomal protein L3P OS=Archaeoglobus fulgidus GN=rpl3p PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 5.104e-17
Identity = 43/121 (35.54%), Postives = 70/121 (57.85%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFG 395
            R+V  +G W+P  V +TV +AGQ G+H RTE NK++ K+G+  +E              ITP GGF HYGV+   Y+L+ G   GP KR++ +R ++  +  +   + + + ++ T+SK G
Sbjct:  226 RRVGNLGPWNPHHVRWTVPQAGQMGFHQRTEYNKRLIKIGENGEE--------------ITPKGGFLHYGVIRTQYVLVTGSVPGPVKRLIRMRDAI--RPPKAHFDGVNIVYVSTTSKQG 330          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_METVS (50S ribosomal protein L3P OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 8.706e-17
Identity = 49/122 (40.16%), Postives = 64/122 (52.46%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGH 398
            R+   IG W P RV +TV  AGQ G+H RTE NK+I KLG    E              ITP GGF +YG V   Y+++KG   GP KR+V LR ++     +  L E+   +I   SK G+
Sbjct:  229 RQTGSIGPWRPKRVMWTVPLAGQMGFHQRTEYNKRILKLGSEGAE--------------ITPKGGFLNYGAVKNGYVVVKGTVQGPAKRLVVLRGAVRPAEDKFGLPEV--TYISKESKQGN 334          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_METVA (50S ribosomal protein L3P OS=Methanococcus vannielii GN=rpl3p PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 8.706e-17
Identity = 49/122 (40.16%), Postives = 64/122 (52.46%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGH 398
            R+   IG W P RV +TV  AGQ G+H RTE NK+I KLG    E              ITP GGF +YG V   Y+++KG   GP KR+V LR ++     +  L E+   +I   SK G+
Sbjct:  229 RQTGSIGPWRPKRVMWTVPLAGQMGFHQRTEYNKRILKLGSEGAE--------------ITPKGGFLNYGAVKNGYVVVKGTVQGPAKRLVVLRGAVRPAEDKFGLPEV--TYISKESKQGN 334          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_METBU (50S ribosomal protein L3P OS=Methanococcoides burtonii (strain DSM 6242) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.257e-15
Identity = 43/110 (39.09%), Postives = 61/110 (55.45%), Query Frame = 3
Query:   30 LRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEI 359
            LR+V  +G W PA VS+ V +AGQ GYH RT+ NK+I K+     E              + P GGF +YG+V  +Y+LIKG   GP KR++ LR+    + S +   +I
Sbjct:  232 LRQVGTLGPWTPAHVSWRVPQAGQMGYHQRTDYNKRILKMSSDVDE--------------VNPAGGFVNYGLVRGNYILIKGSVPGPSKRLIRLREPTRSKVSSIGEPQI 327          
The following BLAST results are available for this feature:
BLAST of DC900117 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 72
Match NameE-valueIdentityDescription
RL3_METST1.754e-1742.6250S ribosomal protein L3P OS=Methanosphaera stadtm... [more]
RL3_METMA1.754e-1739.3450S ribosomal protein L3P OS=Methanosarcina mazei ... [more]
RL3_METMP3.908e-1741.8050S ribosomal protein L3P OS=Methanococcus maripal... [more]
RL3_METM75.104e-1740.9850S ribosomal protein L3P OS=Methanococcus maripal... [more]
RL3_METM65.104e-1740.9850S ribosomal protein L3P OS=Methanococcus maripal... [more]
RL3_METM55.104e-1740.9850S ribosomal protein L3P OS=Methanococcus maripal... [more]
RL3_ARCFU5.104e-1735.5450S ribosomal protein L3P OS=Archaeoglobus fulgidu... [more]
RL3_METVS8.706e-1740.1650S ribosomal protein L3P OS=Methanococcus vanniel... [more]
RL3_METVA8.706e-1740.1650S ribosomal protein L3P OS=Methanococcus vanniel... [more]
RL3_METBU1.257e-1539.0950S ribosomal protein L3P OS=Methanococcoides burt... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900117 VSS Citrus sinensis cDNA clone VS27V32 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900117 ID=DC900117|Name=DC900117|organism=Citrus sinensis|type=EST|length=641bp
CTCGTCTCCCTCGTAAGACTCACCGTGGTCTACGCAAGGTTGCTTGTATT
GGTGCCTGGCATCCGGCTAGGGTCTCCTTTACCGTTGCTAGAGCTGGGCA
GAACGGCTACCATCACCGTACAGAGATGAACAAGAAAATTTACAAGCTTG
GGAAGGCCAGCCAGGAGTCTCATTCTGCCATGACTGAATTTGACAGGACG
GAGAAGGATATCACCCCAATGGGAGGCTTCCCCCACTATGGTGTAGTCAA
TGAAGATTACCTGCTGATCAAGGGCTGCTGTGTTGGACCTAAGAAGCGTG
TTGTGACGTTAAGGCAGTCCCTACTGAAGCAGACGTCTAGGCTTGCATTG
GAGGAGATTAAGCTCAAGTTCATTGACACATCCTCCAAGTTCGGCCATGG
TCGGTTCCAGACAACGCAGGAGAAGGCCAAGTACTATGGAAGGCTCAAGG
CTTGATTTTGGCCAAGTTGAAGAAGAGATTGCCTTTGGTTTCAGGGTAGT
TTTGAACATCTAAGATTTTTGGTCATTCTAGTCTCTATTTTGAATTAATA
TGGCTATGGCTACACTGGCAGTTCTTGGAAACTTCATTTGTGCATGGTTT
GTTTTTTGCGCGTTAATACATCTTACGGTATTTTTGGGCTT
back to top