DC900116

Overview
NameDC900116
Unique NameDC900116
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1107
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3510 contig Csv1_Contig3510:263..1369. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BACHD (Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus halodurans GN=pckA PE=3 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 1.926e-86
Identity = 159/290 (54.83%), Postives = 193/290 (66.55%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXGPN 934
            D NR LIGDDEH W + GV NIEGGCYAKC++LS EKEP IWNAI+FG+VLENV+ DE T   DY+D S+TENTRAAY +E IPN+ IP V  HP  +I L  DAFGVLPP+SKL   Q MYHF+SGYT+ +AGTE G+  P ATFS CFGA F+ L   +YA ML EK+ ++    +LVNTGWSGG YG G R+KL YTR ++ A   G L         VFG+ IPT   GVP  +L P NTW DK+ Y +   +LA  F  NF+ FTN        ++E I   GP+
Sbjct:  245 DPNRKLIGDDEHGWSERGVFNIEGGCYAKCVNLSYEKEPQIWNAIRFGSVLENVIVDEKTGLPDYNDTSLTENTRAAYSLEAIPNSVIPSVAGHPNTIIFLTADAFGVLPPISKLTPEQAMYHFLSGYTSKLAGTERGVTSPEATFSTCFGAPFLPLPAARYAEMLGEKIAQYEVQVFLVNTGWSGGPYGVGQRMKLSYTRAMVQAALQGELNTVETITDSVFGLHIPTRCPGVPDFVLQPRNTWDDKEKYDKKAQELAKQFIENFKRFTN--------VSEAIQKAGPS 526          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BACA2 (Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus amyloliquefaciens (strain FZB42) GN=pckA PE=3 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 4.291e-86
Identity = 153/271 (56.46%), Postives = 186/271 (68.63%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTN 877
            D +R LIGDDEH W D+GV NIEGGCYAKCI+LS EKEP I+ AI+FG+VLENVV DE T E DY +   TENTRAAYPIE I N   P +  HP+ ++ L  DAFGVLPP+SKL   Q MYHF+SGYT+ +AGTE G+  P  TFS CFG+ F+ L    YA ML  K+ +HG   +LVNTGW+GG YG G R+KL YTR ++ A   G L   +     +FG+  P  V GVP E+L PENTW+DKQAY E  L LA  FK NF+ F++
Sbjct:  245 DADRKLIGDDEHGWSDSGVFNIEGGCYAKCINLSEEKEPQIFRAIRFGSVLENVVLDEKTGEADYDNSFYTENTRAAYPIEMIGNIVQPSIAGHPQAIVFLTADAFGVLPPISKLTKEQAMYHFLSGYTSKLAGTERGVTSPQTTFSTCFGSPFLPLPAHVYAEMLGHKIDEHGVQVFLVNTGWTGGGYGVGERMKLSYTRAMVKAAIEGRLNQTDMTADSIFGLRSPVHVPGVPDEVLQPENTWSDKQAYNEKALFLANEFKENFKKFSH 515          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BRASB (Phosphoenolpyruvate carboxykinase [ATP] OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=pckA PE=3 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 2.129e-85
Identity = 155/271 (57.20%), Postives = 191/271 (70.48%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAI-KFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGI-KEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIF 871
            D NR LIGDDEH WG +GV N EGGCYAKCI LS+E EP I+ A  +FGAVLENVV DE +R  D+ D S TENTR+AYP++YIPNA      PHPKNV++LA DAFGVLPP++KL+ AQ MYHF+SGYTA VAGTE G+  EP   FS CFG+ F+ L P+ Y  ML + + +H    WLVNTGW+GG YG GSR+ +  TR ++ A   GSL N  ++    FG  +PT + GVPSEILDP NTWADK  + +T   L G+F++NF  F
Sbjct:  247 DPNRTLIGDDEHGWGPSGVFNFEGGCYAKCIKLSQEAEPQIFAASNRFGAVLENVVLDEDSRVPDFDDGSKTENTRSAYPLDYIPNASRTGRAPHPKNVVMLAADAFGVLPPIAKLSPAQAMYHFLSGYTAKVAGTERGLGNEPQPEFSTCFGSPFLPLDPSVYGNMLRQLIAEHNVDCWLVNTGWTGGKYGTGSRMPIKVTRALLTAALDGSLRNVEFRTDKYFGFAVPTALPGVPSEILDPVNTWADKAEFDKTARALVGMFQKNFAKF 517          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_GEOTN (Phosphoenolpyruvate carboxykinase [ATP] OS=Geobacillus thermodenitrificans (strain NG80-2) GN=pckA PE=3 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 2.781e-85
Identity = 153/292 (52.40%), Postives = 194/292 (66.44%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTN 877
            ++G VA               D  R LIGDDEH W   G+ NIEGGCYAKCI+LSREKEP I++AI FGAVLENV+  + TR  DY D ++TENTRAAYP++ I N   P V  HP  ++ L  DAFGVLPP+SKL   Q MYHF+SGYT+ +AGTE G+ EP ATFS CFGA F+     +YA ML +K+ +H    +LVNTGW+GG YG GSR+KL YTR ++ A   G L N    +  +FG+ IP  V GVP ++L P+NTWADKQAY++   +LA  F+ NF+ F +
Sbjct:  224 QEGDVALFFGLSGTGKTTLSTDPKRRLIGDDEHGWSSRGIFNIEGGCYAKCINLSREKEPQIFDAIGFGAVLENVILHDATRVPDYDDGTLTENTRAAYPLQAIKNIVDPSVAGHPSTIVFLTADAFGVLPPISKLTREQAMYHFLSGYTSKLAGTERGVTEPEATFSTCFGAPFLPRPAVEYAEMLGQKIAEHNVRVFLVNTGWTGGPYGVGSRMKLAYTRAMVQAAVEGELDNVETVQDPIFGLAIPAHVPGVPDDVLRPQNTWADKQAYEQKAKELAEKFRANFQKFAH 515          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_RUBXD (Phosphoenolpyruvate carboxykinase [ATP] OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=pckA PE=3 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 3.632e-85
Identity = 159/291 (54.64%), Postives = 202/291 (69.42%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTE-DGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXGPN 934
            D  RYLIGDDEH W D G+ N EGGCYAKCIDLSREKEP I++AI+FGAVLENVV D  TR VDYSD S+TENTRAAYP+EYI  A       HP  V+ L  DAFGVLPP+S L+  Q  Y+F+SGYTA +AGTE D   +  ATFSACFGA F+ L  T YAAML+EK+++HG+  +L+NTGWSGG YG G R+ +  TR+++ A+ +G++  +       FG+++P EV GVPS IL+P  TWAD+ AY +   KLA LF+ NF+ F       ++ + E +   GPN
Sbjct:  248 DPERYLIGDDEHGWSDEGIFNFEGGCYAKCIDLSREKEPQIYDAIRFGAVLENVVVDRITRRVDYSDASLTENTRAAYPLEYIEGAVDSGRAGHPAAVLFLTADAFGVLPPISVLSPEQAAYYFLSGYTAKLAGTEADMEADVEATFSACFGAPFLPLPATTYAAMLSEKLREHGSRCYLINTGWSGGPYGVGERVDIAATRQMVRAVIAGNIDESKTYTDPFFGLQVPLEVPGVPSGILNPRETWADRAAYDDQAAKLADLFRENFKKF-------EDGVPEGVRKAGPN 531          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_GRAFK (Phosphoenolpyruvate carboxykinase [ATP] OS=Gramella forsetii (strain KT0803) GN=pckA PE=3 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 3.632e-85
Identity = 158/311 (50.80%), Postives = 202/311 (64.95%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWG-DNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXGP 931
            +DG  A               D  R LIGDDEH W  +N + N EGGCYAK I+LS E EPDI+ AIK GA+LENV  D +  +VD+ D ++T+NTR +YPI +I N + P  G +PKN+  L  DAFGVLPP+SKL   Q  YHFISGYTA VAGTE G+ EP  +FSACFGA F+ LHPT+YA ML++KM+      WLVNTGW+GG YG GSR+KL YTR++I +   G L N +Y+K ++FG+E+P   EGVPSE+L+P NTW D+ AY     +L+  F++NF  F  Y         EEI+   P
Sbjct:  228 EDGDTAIFFGLSGTGKTTLSADPERKLIGDDEHGWTKENTIFNFEGGCYAKVINLSEENEPDIYKAIKPGAILENVALDANG-DVDFEDVTITQNTRVSYPINHINNIQKPSTGENPKNIFFLTADAFGVLPPISKLTPGQAAYHFISGYTAKVAGTEAGVDEPVPSFSACFGAPFMPLHPTEYAEMLSKKMKAADVNVWLVNTGWTGGPYGVGSRMKLKYTREMISSALEGKLENVDYEKHNIFGLEMPKTCEGVPSEVLNPRNTWKDQNAYDLKAKELSNFFRKNFRKFEEY-------ANEEIMNGAP 530          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_FUSNN (Phosphoenolpyruvate carboxykinase [ATP] OS=Fusobacterium nucleatum subsp. nucleatum GN=pckA PE=3 SV=2)

HSP 1 Score: 315.464 bits (807), Expect = 3.632e-85
Identity = 151/291 (51.89%), Postives = 196/291 (67.35%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXGPNF 937
            D NR LIGDDEH W D G+ N EGGCYAKCI+L  E EP+I+ AIKFG+++ENVV D  TR++ Y D S+T NTR  YPI+YIPNA++  VG  PK VI L  D+FGVLPP+S+L+    MYHF++G+TA +AGTE G+KEP  TFS CFG  F+ + P+ YA ML E+++KH    +L+NTGWSGG+YG G RI L YTR ++ A+ +G   NA YK  D+F ++IP    GVPSEI++P +TW D+  Y     KLA LF  NF+        K   + E I   GP +
Sbjct:  240 DPNRKLIGDDEHGWCDKGIFNFEGGCYAKCINLKEESEPEIYRAIKFGSLVENVVVDPITRKIQYEDASITPNTRVGYPIDYIPNAELSGVGGIPKVVIFLTADSFGVLPPISRLSQEAAMYHFVTGFTAKLAGTELGVKEPVPTFSTCFGEPFMPMDPSVYAEMLGERLKKHNTKVYLINTGWSGGAYGTGKRINLKYTRAMVTAVLNGYFDNAEYKHDDIFNLDIPQSCPGVPSEIMNPIDTWQDRDKYIIAAKKLANLFYNNFK-------EKYPNMPENITNAGPKY 523          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BREBN (Phosphoenolpyruvate carboxykinase [ATP] OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=pckA PE=3 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 1.057e-84
Identity = 151/288 (52.43%), Postives = 186/288 (64.58%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFE 865
            KDG VA               D +R+LIGDDEH W DNGV NIEGGCYAKC+ LS E EP IW AI+FG VLENV  +E TR  DY     TENTRAAYP+E IP A IP VG  P  ++ L  D+FGVLPP+SKLN  Q MYHF+SGYT+ +AGTE G+  P   FS CFG+ F+ LHP  YA ML +K+ +     +LVNTGW+GG  G G R+KL YTR ++ A  +G L   +Y   ++FGV++PT    VP+E+L P NTWA+K+ Y +    LA  F  NFE
Sbjct:  223 KDGDVALFFGLSGTGKTTLSADPDRFLIGDDEHGWSDNGVFNIEGGCYAKCVKLSEEGEPQIWKAIQFGTVLENVDVNEATRVADYDSTKYTENTRAAYPVEAIPGAVIPGVGGQPNVIVFLTADSFGVLPPISKLNKEQAMYHFLSGYTSKMAGTERGVTAPQTEFSTCFGSPFLPLHPVVYAEMLGKKIDERKVQVYLVNTGWTGGPVGVGQRMKLSYTRAMVTAALNGELEKVDYVADEIFGVQVPTSCPNVPAEVLQPRNTWANKEDYDKQAADLAARFIENFE 510          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_CAMLR (Phosphoenolpyruvate carboxykinase [ATP] OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=pckA PE=3 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 1.380e-84
Identity = 155/280 (55.36%), Postives = 197/280 (70.36%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKL 904
            D  R LIGDDEH W D GV N EGGCYAKCI+L  + EP+I+ AIK  A+LENVV  +    VD+++ S TENTR +YPIE+I N +      HP N+I L+ DAFGVLPPVSKL+  Q MY+F+SGYTA VAGTE GI EP ATFSACFG  F+ LHPT YA +L EK+ KH    +LVNTGWSGG+YG G R+ +  TR  I+AI  GS+ N  ++  D+F + +P E+ GV S++L+P NTW DK+AY+ET LKLA +F  NF+ + + K G + KL
Sbjct:  241 DPKRRLIGDDEHGWDDEGVFNFEGGCYAKCINLDPQSEPEIYGAIKQNALLENVVLKDDL-SVDFNNGSKTENTRVSYPIEHILNHEPSLSAGHPSNIIFLSADAFGVLPPVSKLSKEQAMYYFLSGYTAKVAGTERGITEPVATFSACFGEVFLPLHPTVYAKLLGEKISKHNVNVYLVNTGWSGGAYGVGKRMSIKATRACINAILDGSIQNCEFENYDLFNLAVPKELAGVESKLLNPINTWEDKKAYEETKLKLAKMFIENFKRYEDVKEGAEFKL 519          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_RHOP5 (Phosphoenolpyruvate carboxykinase [ATP] OS=Rhodopseudomonas palustris (strain BisA53) GN=pckA PE=3 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 1.803e-84
Identity = 152/270 (56.30%), Postives = 190/270 (70.37%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAI-KFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIF 871
            D NR LIGDDEH WG +GV N EGGCYAKCI LS E EP+I+ A  +FGA+LEN V D  TR+ D++D S TENTR+AYP+E IPNA +      PKNV++LA DAFGV+PP++KL  AQ MYHF+SGYTA VAGTE G+ EP+  FS CFG+ F+   P+ Y  ML E + KHG   WLVNTGW+GG YG GSR+ +  TR ++ A  +GSL N  ++    FG  +PT + GVPS+ILDP  TWADK A+  T  KL G+F++NF  F
Sbjct:  248 DPNRTLIGDDEHGWGKDGVFNFEGGCYAKCIKLSAEAEPEIFAASNRFGAILENTVLDPITRKPDFNDGSKTENTRSAYPLESIPNASLTGRAGLPKNVVMLAADAFGVMPPIAKLTPAQAMYHFLSGYTAKVAGTERGVTEPSPVFSTCFGSPFLPRDPSVYGNMLRELIAKHGVDCWLVNTGWTGGIYGTGSRMPIKVTRALLTAALNGSLRNVEFRTDPYFGFAVPTALPGVPSDILDPVKTWADKAAFDVTARKLVGMFQKNFSKF 517          
The following BLAST results are available for this feature:
BLAST of DC900116 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 284
Match NameE-valueIdentityDescription
PCKA_BACHD1.926e-8654.83Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillu... [more]
PCKA_BACA24.291e-8656.46Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillu... [more]
PCKA_BRASB2.129e-8557.20Phosphoenolpyruvate carboxykinase [ATP] OS=Bradyrh... [more]
PCKA_GEOTN2.781e-8552.40Phosphoenolpyruvate carboxykinase [ATP] OS=Geobaci... [more]
PCKA_RUBXD3.632e-8554.64Phosphoenolpyruvate carboxykinase [ATP] OS=Rubroba... [more]
PCKA_GRAFK3.632e-8550.80Phosphoenolpyruvate carboxykinase [ATP] OS=Gramell... [more]
PCKA_FUSNN3.632e-8551.89Phosphoenolpyruvate carboxykinase [ATP] OS=Fusobac... [more]
PCKA_BREBN1.057e-8452.43Phosphoenolpyruvate carboxykinase [ATP] OS=Breviba... [more]
PCKA_CAMLR1.380e-8455.36Phosphoenolpyruvate carboxykinase [ATP] OS=Campylo... [more]
PCKA_RHOP51.803e-8456.30Phosphoenolpyruvate carboxykinase [ATP] OS=Rhodops... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900116 VSS Citrus sinensis cDNA clone VS27V30 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900116 ID=DC900116|Name=DC900116|organism=Citrus sinensis|type=EST|length=1107bp
AAAAGATGGCNATGTTGCCCTCTTCTTTGGATTGTCAGGTACTGGAAAGA
CAACACTGTCTACTGATCACAATCGATATCTGATTGGAGACGATGAACAC
TGTTGGGGTGACAATGGTGTGTCAAACATTGAGGGTGGTTGCTATGCCAA
GTGCATTGATCTCTCAAGGGAGAAGGAGCCTGATATCTGGAATGCCATCA
AGTTTGGCGCTGTGTTGGAAAATGTTGTGTTTGATGAGCATACCAGAGAG
GTGGATTATTCTGACAAATCTGTCACAGAGAACACTCGTGCTGCCTACCC
CATTGAGTATATCCCCAATGCAAAGATACCATGCGTTGGTCCTCATCCCA
AGAATGTCATCCTTTTGGCATGTGATGCTTTTGGTGTACTCCCACCAGTG
AGCAAGCTGAACCTGGCACAAACAATGTACCATTTCATCAGTGGCTACAC
TGCTTTGGTAGCTGGAACAGAGGATGGTATTAAGGAGCCAACGGCAACAT
TTTCAGCTTGCTTTGGTGCAGCATTTATCATGCTGCATCCTACCAAGTAT
GCAGCAATGCTGGCTGAGAAGATGCAGAAGCATGGTGCTACAGGATGGCT
CGTCAACACTGGATGGTCAGGTGGAAGCTATGGTTGTGGCAGCCGCATCA
AGTTACCGTACACTCGAAAAATCATTGATGCGATACACTCTGGCAGCCTG
TTGAATGCAAATTACAAGAAAACTGATGTATTTGGGGTGGAAATCCCCAC
TGAAGTCGAGGGAGTGCCTTCAGAAATCCTGGATCCAGAGAACACTTGGG
CAGACAAGCAGGCTTACAAGGAGACACTGCTGAAGCTGGCTGGTCTTTTC
AAGAGGAACTTTGAAATATTCACAAACTACAAGATTGGCAAGGACAACAA
GCTCACTGAAGAGATCCTTGNANCTGGTCCAAATTTCTAATTTAGACCGA
GTGAAGAACAAGCAAAGAACGTGAGTGTGGTTTGGGAAATATGATGGAAA
TAAAGCGTAATATAGTCATATTCGACATGTGTGGTTCGATTCATATGTAA
ACTTGTTCTCCTGNATTAATTAAGTAATCCAAAAATTTGAGTCANCGATT
TTAATTA
back to top