DC900116

Overview
NameDC900116
Unique NameDC900116
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1107
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3510 contig Csv1_Contig3510:263..1369. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_OLICO (Phosphoenolpyruvate carboxykinase [ATP] OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=pckA PE=3 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 2.436e-81
Identity = 149/271 (54.98%), Postives = 187/271 (69.00%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNA-IKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGI-KEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIF 871
            D  R L+GDDEH WG +GV N EGGCYAK I LSRE EP I++A ++FGAVLENVV D  TR VD+ D S TENTR+AYP++ IPNA        PKN+++LA DAFGVLPP++KL  +Q MYHF+SGYTA VAGTE G+  EP   FSACFGA F+   PT Y  ML + + KH    WLVNTGW+GG +G G+R+ +  TR ++ A   GSL N  ++    FG  +PT + GVPS+ILDP NTWADK  +K+T   L  +F++NF  F
Sbjct:  248 DPQRTLLGDDEHGWGPDGVFNFEGGCYAKTIRLSREAEPAIYDASLRFGAVLENVVVDSQTRAVDFDDGSKTENTRSAYPLDAIPNASPTGCAGQPKNIVMLAADAFGVLPPIAKLTPSQAMYHFLSGYTAKVAGTERGLGSEPQPEFSACFGAPFLPRDPTVYGEMLRKLIAKHNVDCWLVNTGWTGGKFGIGNRMPIKVTRALLTAALDGSLRNVTFRTDPYFGFAVPTALPGVPSDILDPINTWADKADFKKTAQALVSMFRQNFTKF 518          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_ROSDO (Phosphoenolpyruvate carboxykinase [ATP] OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=pckA PE=3 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 3.182e-81
Identity = 143/268 (53.36%), Postives = 181/268 (67.54%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAI-KFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFE 865
            D  R LIGDDEH W D G  N EGGCYAK I L+ E EP+I+    KFG V+EN+V+D  T+++D+ D S+T N R AYP+ YI NA     G HPKN+I+L CDAFGVLPP+S+L  AQ MYHF+SG+T+ VAGTE G+ EP  TFS CFGA F+   P  Y  +L EK+  HGAT WLVNTGW+GG+YG GSR+ +  TR ++ A   GSL +A ++K   FG ++P +V GVP  +LDP  TW D +AY     KL  +F  NFE
Sbjct:  249 DPARTLIGDDEHGWSDTGTFNFEGGCYAKTISLNPEAEPEIYATTEKFGTVIENMVYDAETKDLDFEDDSLTANMRCAYPLHYISNASQAARGGHPKNIIMLTCDAFGVLPPISRLTPAQAMYHFLSGFTSKVAGTERGVTEPEPTFSTCFGAPFMPRRPEVYGNLLREKIATHGATCWLVNTGWTGGAYGTGSRMPIKATRGLLTAALDGSLADAEFRKDPNFGFQVPVDVTGVPGILLDPRRTWDDAEAYDRQAAKLVKMFSDNFE 516          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_DINSH (Phosphoenolpyruvate carboxykinase [ATP] OS=Dinoroseobacter shibae (strain DFL 12) GN=pckA PE=3 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 3.182e-81
Identity = 143/273 (52.38%), Postives = 182/273 (66.67%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIK-FGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNY 880
            D  R LIGDDEH W + G  N EGGCYAK I+LS E EP+I+   + FG V+EN+VFD  T ++D+ D S+T N R AYP+ YI NA    +G HPKN+I+L CDAFGVLPP+S+L  AQ MYHF+SG+T+ VAGTE G+ EP  TFS CFGA F+   P  Y  +L EK+ KHGAT WLVNTGW+GG+YG GSR+ +  TR ++ A   GSL +A ++K   FG ++P  V GV + +LDP  TW D  AY     KL  +F  NF  +  Y
Sbjct:  249 DPERVLIGDDEHGWSERGTFNFEGGCYAKTINLSAEAEPEIYATTEMFGTVIENMVFDPETLDLDFEDDSLTANMRCAYPLNYISNASETALGGHPKNIIMLTCDAFGVLPPISRLTPAQAMYHFLSGFTSKVAGTERGVTEPEPTFSTCFGAPFMPRRPEVYGKLLQEKIAKHGATCWLVNTGWTGGAYGTGSRMPIKATRALLTAALDGSLADATFRKDANFGFDVPVTVHGVDATLLDPRGTWEDSAAYDAQAQKLVEMFAENFAQYVPY 521          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BRUSU (Phosphoenolpyruvate carboxykinase [ATP] OS=Brucella suis GN=pckA PE=3 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 4.156e-81
Identity = 149/273 (54.58%), Postives = 188/273 (68.86%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAI-KFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNY 880
            D  R LIGDDEH WG++GV N EGGCYAK I LS E EP+I+    +FG VLENVV DE+ R+ D+ D S+TENTR AYP+++IPNA     G  PKN+I+L  DAFGV+PP++KL  AQ MYHF+SGYTA VAGTE G+ EP ATFS CFGA F+  HP++Y  +L + + +H    WLVNTGW+GG+YG G R+ +  TR ++ A   GSL NA ++    FG  +P EV GV S ILDP +TWADK AY     KL  +F  NFE F ++
Sbjct:  248 DPTRTLIGDDEHGWGEHGVFNFEGGCYAKTIRLSAEAEPEIYATTQRFGTVLENVVLDEN-RQPDFDDGSLTENTRCAYPLDFIPNASKSGKGGQPKNIIMLTADAFGVMPPIAKLTPAQAMYHFLSGYTAKVAGTEKGVTEPEATFSTCFGAPFMPRHPSEYGNLLRKLIAEHKVDCWLVNTGWTGGAYGVGKRMPIKATRALLAAALDGSLNNAEFRIDPNFGFAVPVEVPGVESSILDPRSTWADKVAYDAQAKKLVDMFVSNFEKFESH 519          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_CAMJR (Phosphoenolpyruvate carboxykinase [ATP] OS=Campylobacter jejuni (strain RM1221) GN=pckA PE=3 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 5.428e-81
Identity = 153/275 (55.64%), Postives = 190/275 (69.09%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIG 889
            D  R LIGDDEH W D GV N EGGCYAK I+L+ E EP+I+ AIK  A+LENVV     + VDY+D S TENTR +YPIE+I N +      HPKN+I L+ DAFG+LPPVSKL+  Q MY+F+SGYTA VAGTE GI EP ATFSACFG  F+ LHPT YA +L EK++KH    +LVNTGWSGGSY  G R+ +  TR  I+AI  GS+    ++  +VF + IP  +EGV S +L+P NTW DK AY  T  KLA +F +NF+ + + K G
Sbjct:  241 DPKRRLIGDDEHGWDDEGVFNFEGGCYAKTINLNPEHEPEIYGAIKRNALLENVVL-RADKSVDYADASKTENTRVSYPIEHIENHEPSLKAGHPKNIIFLSADAFGILPPVSKLSKEQAMYYFLSGYTAKVAGTERGITEPQATFSACFGEPFMPLHPTVYARLLGEKIEKHEVNVYLVNTGWSGGSYSVGKRMSIKATRACINAILDGSITKCEFENFEVFDLAIPKALEGVESVLLNPINTWLDKNAYIATRDKLAHMFIQNFKRYEDVKEG 514          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BRUC2 (Phosphoenolpyruvate carboxykinase [ATP] OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=pckA PE=3 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 9.258e-81
Identity = 148/273 (54.21%), Postives = 188/273 (68.86%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAI-KFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNY 880
            D  R LIGDDEH WG++GV N EGGCYAK I LS E EP+I+    +FG VLENVV DE+ R+ D+ D S+TENTR AYP+++IPNA     G  PKN+I+L  DAFGV+PP++KL  AQ MYHF+SGYTA VAGTE G+ EP ATFS CFGA F+  HP++Y  +L + + +H    WLVNTGW+GG+YG G R+ +  TR ++ A   GSL NA ++    FG  +P EV GV + ILDP +TWADK AY     KL  +F  NFE F ++
Sbjct:  248 DPTRTLIGDDEHGWGEHGVFNFEGGCYAKTIRLSAEAEPEIYATTQRFGTVLENVVLDEN-RQPDFDDGSLTENTRCAYPLDFIPNASKSGKGGQPKNIIMLTADAFGVMPPIAKLTPAQAMYHFLSGYTAKVAGTEKGVTEPEATFSTCFGAPFMPRHPSEYGNLLRKLIAEHKVDCWLVNTGWTGGAYGVGKRMPIKATRALLAAALDGSLNNAEFRIDPNFGFAVPVEVPGVENSILDPRSTWADKVAYDAQAKKLVDMFVSNFEKFESH 519          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_STAS1 (Phosphoenolpyruvate carboxykinase [ATP] OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=pckA PE=3 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 1.209e-80
Identity = 144/269 (53.53%), Postives = 184/269 (68.40%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIF 871
            D  R LIGDDEH W +NG+ NIEGGCYAK I+LS++KEP I++AIK+G +LENVV DE   +VD+ D   TENTRAAYPI +I N   P    HP  +I L  DAFGVLPP+SKL   Q MYHF+SG+TA +AGTE G+ EP  +FS CFG+ F+ L+   YA +L   + KHG   +LVNTGW+GG YG G RI L YTR++++   +G L +A Y K D+FG++IP EVE VP  +L+P N W+  +AY+     L   FK NFE F
Sbjct:  248 DPTRKLIGDDEHGWNNNGIFNIEGGCYAKAINLSQKKEPQIYDAIKYGTILENVVVDEEG-DVDFDDNQYTENTRAAYPIHHIDNIVTPSKAAHPNTIIFLTADAFGVLPPISKLTKDQAMYHFLSGFTAKLAGTERGVTEPEPSFSTCFGSPFLPLNAKVYADLLGNLIDKHGVDVYLVNTGWTGGKYGVGRRISLNYTRQMVNQAITGKLRDAEYVKDDMFGLDIPVEVEDVPQTLLNPINAWSKPEAYRTQAQDLINRFKSNFEKF 515          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BRUME (Phosphoenolpyruvate carboxykinase [ATP] OS=Brucella melitensis GN=pckA PE=3 SV=2)

HSP 1 Score: 299.671 bits (766), Expect = 2.063e-80
Identity = 148/273 (54.21%), Postives = 187/273 (68.50%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAI-KFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNY 880
            D  R LIGDDEH WG++GV N EGGCYAK I LS E EP+I+    +FG VLENVV DE+ R+ D+ D S+TENTR AYP+++IPNA     G  PKN+I+L  DAFGV+PP++KL  AQ MYHF+SGYTA VA TE G+ EP ATFS CFGA F+  HP++Y  +L + + +H    WLVNTGW+GG+YG G R+ +  TR ++ A   GSL NA ++    FG  +P EV GV S ILDP +TWADK AY     KL  +F  NFE F ++
Sbjct:  248 DPTRTLIGDDEHGWGEHGVFNFEGGCYAKTIRLSAEAEPEIYATTQRFGTVLENVVLDEN-RQPDFDDGSLTENTRCAYPLDFIPNASKSGKGGQPKNIIMLTADAFGVMPPIAKLTPAQAMYHFLSGYTAKVAATEKGVTEPEATFSTCFGAPFMPRHPSEYGNLLRKLIAEHKVDCWLVNTGWTGGAYGVGKRMPIKATRALLAAALDGSLNNAEFRIDPNFGFAVPVEVPGVESSILDPRSTWADKVAYDAQAKKLVDMFVSNFEKFESH 519          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_STAHJ (Phosphoenolpyruvate carboxykinase [ATP] OS=Staphylococcus haemolyticus (strain JCSC1435) GN=pckA PE=3 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 2.694e-80
Identity = 143/267 (53.56%), Postives = 182/267 (68.16%), Query Frame = 2
Query:   71 NRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIF 871
            +R LIGDDEH W  NG+ NIEGGCYAK I+LS+EKEP I+NAI++G +LEN V +E    VD+ D S TENTRAAYPI +I N  +P    HP  +I L  DAFGVLPP++KL  +Q MYHF+SG+T+ +AGTE G+ EP  +FS CFGA F+ L+P KYA +L E + KH    +LVNTGW+GG YG G RI L YTR ++D    G L NA + K + FG+ IPTE+E VP  IL+P N W+D   Y+     L   F+ NF+ F
Sbjct:  250 DRKLIGDDEHGWNKNGIFNIEGGCYAKAINLSKEKEPQIYNAIQYGTILENTVVNERG-VVDFDDNSYTENTRAAYPIHHIDNIVLPSKAAHPNTIIFLTADAFGVLPPIAKLTKSQAMYHFLSGFTSKLAGTERGVTEPEPSFSTCFGAPFLPLNPNKYADLLGELIDKHDVDVYLVNTGWTGGKYGVGRRISLHYTRYMVDQAIKGKLKNAEFTKDEKFGLSIPTEMEDVPKTILNPINAWSDSDKYRAQADDLIQRFEENFKKF 515          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_LEPBP (Phosphoenolpyruvate carboxykinase [ATP] OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=pckA PE=3 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 3.518e-80
Identity = 150/288 (52.08%), Postives = 190/288 (65.97%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFE 865
            KDG  A               D NR LIGDDEH W DNG+ NIEGGCYAK I+L  + EP+I+ AI+  A+LENVV+D  T++VDYS  + TENTR +YPI +I N +      HP  VI L  DA+GVLP VSKL++ Q MYHF+SGYTA VAGTE G+KEP ATFSACFG AF+ LHPT YA +L EKM+KH    +L+NTG  GG YG G R+ LP TR+II+ I +G++  + ++K  VF V  P  V GV + IL+P N W +K+ Y +T   LA  F  N++
Sbjct:  225 KDGDSALFFGLSGTGKTTLSTDPNRKLIGDDEHGWDDNGIFNIEGGCYAKTINLDPKTEPEIYAAIRRDALLENVVYDATTKKVDYSSAAKTENTRVSYPIFHIDNIQPGSKAGHPNTVIFLTYDAYGVLPAVSKLSIEQAMYHFLSGYTAKVAGTERGVKEPQATFSACFGQAFMTLHPTYYAKLLGEKMKKHQVNAYLINTGLVGGKYGVGKRMNLPATRQIINEILNGNIEKSEFEKHPVFQVSFPKSVNGVDAHILNPRNAWENKEDYDKTAADLAKQFVENYK 512          
The following BLAST results are available for this feature:
BLAST of DC900116 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 284
Match NameE-valueIdentityDescription
PCKA_OLICO2.436e-8154.98Phosphoenolpyruvate carboxykinase [ATP] OS=Oligotr... [more]
PCKA_ROSDO3.182e-8153.36Phosphoenolpyruvate carboxykinase [ATP] OS=Roseoba... [more]
PCKA_DINSH3.182e-8152.38Phosphoenolpyruvate carboxykinase [ATP] OS=Dinoros... [more]
PCKA_BRUSU4.156e-8154.58Phosphoenolpyruvate carboxykinase [ATP] OS=Brucell... [more]
PCKA_CAMJR5.428e-8155.64Phosphoenolpyruvate carboxykinase [ATP] OS=Campylo... [more]
PCKA_BRUC29.258e-8154.21Phosphoenolpyruvate carboxykinase [ATP] OS=Brucell... [more]
PCKA_STAS11.209e-8053.53Phosphoenolpyruvate carboxykinase [ATP] OS=Staphyl... [more]
PCKA_BRUME2.063e-8054.21Phosphoenolpyruvate carboxykinase [ATP] OS=Brucell... [more]
PCKA_STAHJ2.694e-8053.56Phosphoenolpyruvate carboxykinase [ATP] OS=Staphyl... [more]
PCKA_LEPBP3.518e-8052.08Phosphoenolpyruvate carboxykinase [ATP] OS=Leptosp... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900116 VSS Citrus sinensis cDNA clone VS27V30 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900116 ID=DC900116|Name=DC900116|organism=Citrus sinensis|type=EST|length=1107bp
AAAAGATGGCNATGTTGCCCTCTTCTTTGGATTGTCAGGTACTGGAAAGA
CAACACTGTCTACTGATCACAATCGATATCTGATTGGAGACGATGAACAC
TGTTGGGGTGACAATGGTGTGTCAAACATTGAGGGTGGTTGCTATGCCAA
GTGCATTGATCTCTCAAGGGAGAAGGAGCCTGATATCTGGAATGCCATCA
AGTTTGGCGCTGTGTTGGAAAATGTTGTGTTTGATGAGCATACCAGAGAG
GTGGATTATTCTGACAAATCTGTCACAGAGAACACTCGTGCTGCCTACCC
CATTGAGTATATCCCCAATGCAAAGATACCATGCGTTGGTCCTCATCCCA
AGAATGTCATCCTTTTGGCATGTGATGCTTTTGGTGTACTCCCACCAGTG
AGCAAGCTGAACCTGGCACAAACAATGTACCATTTCATCAGTGGCTACAC
TGCTTTGGTAGCTGGAACAGAGGATGGTATTAAGGAGCCAACGGCAACAT
TTTCAGCTTGCTTTGGTGCAGCATTTATCATGCTGCATCCTACCAAGTAT
GCAGCAATGCTGGCTGAGAAGATGCAGAAGCATGGTGCTACAGGATGGCT
CGTCAACACTGGATGGTCAGGTGGAAGCTATGGTTGTGGCAGCCGCATCA
AGTTACCGTACACTCGAAAAATCATTGATGCGATACACTCTGGCAGCCTG
TTGAATGCAAATTACAAGAAAACTGATGTATTTGGGGTGGAAATCCCCAC
TGAAGTCGAGGGAGTGCCTTCAGAAATCCTGGATCCAGAGAACACTTGGG
CAGACAAGCAGGCTTACAAGGAGACACTGCTGAAGCTGGCTGGTCTTTTC
AAGAGGAACTTTGAAATATTCACAAACTACAAGATTGGCAAGGACAACAA
GCTCACTGAAGAGATCCTTGNANCTGGTCCAAATTTCTAATTTAGACCGA
GTGAAGAACAAGCAAAGAACGTGAGTGTGGTTTGGGAAATATGATGGAAA
TAAAGCGTAATATAGTCATATTCGACATGTGTGGTTCGATTCATATGTAA
ACTTGTTCTCCTGNATTAATTAAGTAATCCAAAAATTTGAGTCANCGATT
TTAATTA
back to top