DC900094

Overview
NameDC900094
Unique NameDC900094
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length552
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900094_ssr357 microsatellite DC900094_ssr357:357..366. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig13712 contig Csv1_Contig13712:294..845. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900094 vs. ExPASy Swiss-Prot
Match: PPA6_ARATH (Purple acid phosphatase 6 OS=Arabidopsis thaliana GN=PAP6 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 6.474e-22
Identity = 32/51 (62.75%), Postives = 41/51 (80.39%), Query Frame = 2
Query:  107 PQPDYSAFREASYGHSTLEIKNRTHAFYHWNRNDDGKKVATDSFILHNQYW 259
            PQP YSA+REAS+GH+ LEI NRTHA Y W+RN D + VA DS +LHN+++
Sbjct:  403 PQPSYSAYREASFGHAVLEIMNRTHAQYTWHRNQDNEPVAADSIMLHNRHF 453          

HSP 2 Score: 50.0618 bits (118), Expect = 6.474e-22
Identity = 23/41 (56.10%), Postives = 31/41 (75.61%), Query Frame = 3
Query:    3 DVVFAGHVHAYERSYRISNLHYNISSGDCFPVPDIHSQIIL 125
            D+V +GHVHAYERS RISN+ YNI++G   PV D ++ I +
Sbjct:  345 DLVLSGHVHAYERSERISNIKYNITNGLSSPVKDPNAPIYI 385          
BLAST of DC900094 vs. ExPASy Swiss-Prot
Match: PPA19_ARATH (Purple acid phosphatase 19 OS=Arabidopsis thaliana GN=PAP19 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.526e-20
Identity = 32/55 (58.18%), Postives = 39/55 (70.91%), Query Frame = 2
Query:  107 PQPDYSAFREASYGHSTLEIKNRTHAFYHWNRNDDG----KKVATDSFILHNQYW 259
            PQP YSAFREAS+GH+ LEIKNRTHA Y W+RN +     + V  DS  L N+Y+
Sbjct:  327 PQPSYSAFREASFGHAILEIKNRTHAHYTWHRNKEDEFIPEAVIADSIWLKNRYY 381          

HSP 2 Score: 54.299 bits (129), Expect = 1.526e-20
Identity = 24/41 (58.54%), Postives = 31/41 (75.61%), Query Frame = 3
Query:    3 DVVFAGHVHAYERSYRISNLHYNISSGDCFPVPDIHSQIIL 125
            D+VFAGHVHAYERS RISN+ YNI+ G   PV D ++ + +
Sbjct:  269 DIVFAGHVHAYERSERISNIQYNITDGMSTPVKDQNAPVYI 309          
BLAST of DC900094 vs. ExPASy Swiss-Prot
Match: PPA18_ARATH (Purple acid phosphatase 18 OS=Arabidopsis thaliana GN=PAP18 PE=2 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.939e-11
Identity = 22/48 (45.83%), Postives = 33/48 (68.75%), Query Frame = 2
Query:  107 PQPDYSAFREASYGHSTLEIKNRTHAFYHWNRNDDGKKVATDSFILHN 250
            P P++S FREAS+GH  L++ N THA + W+RNDD +   +D   L++
Sbjct:  369 PSPEWSVFREASFGHGELQMVNSTHALWTWHRNDDDEPTRSDEVWLNS 416          

HSP 2 Score: 35.4242 bits (80), Expect = 1.939e-11
Identity = 13/19 (68.42%), Postives = 17/19 (89.47%), Query Frame = 3
Query:    3 DVVFAGHVHAYERSYRISN 59
            D+VF GHVHAYER+ R++N
Sbjct:  322 DIVFTGHVHAYERTKRVNN 340          
BLAST of DC900094 vs. ExPASy Swiss-Prot
Match: PPA20_ARATH (Probable inactive purple acid phosphatase 20 OS=Arabidopsis thaliana GN=PAP20 PE=2 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 9.278e-11
Identity = 24/45 (53.33%), Postives = 30/45 (66.67%), Query Frame = 2
Query:  101 RYPQPDYSAFREASYGHSTLEIKNRTHAFYHWNRNDDGKKVATDS 235
            R P P+ S FREAS+GH  L ++N THA + W+RNDD   V  DS
Sbjct:  369 RDPNPEISLFREASFGHGQLVVENATHARWEWHRNDDDVSVEKDS 413          

HSP 2 Score: 33.113 bits (74), Expect = 9.278e-11
Identity = 17/32 (53.12%), Postives = 19/32 (59.38%), Query Frame = 3
Query:    3 DVVFAGHVHAYERSYRISNLHYNISSGDCFPV 98
            D+VFAGHVHAYER  R+    Y      C PV
Sbjct:  324 DLVFAGHVHAYERFSRV----YQDKFDKCGPV 351          
The following BLAST results are available for this feature:
BLAST of DC900094 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 14
Match NameE-valueIdentityDescription
PPA6_ARATH6.474e-2262.75Purple acid phosphatase 6 OS=Arabidopsis thaliana ... [more]
PPA19_ARATH1.526e-2058.18Purple acid phosphatase 19 OS=Arabidopsis thaliana... [more]
PPA18_ARATH1.939e-1145.83Purple acid phosphatase 18 OS=Arabidopsis thaliana... [more]
PPA20_ARATH9.278e-1153.33Probable inactive purple acid phosphatase 20 OS=Ar... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900094 VSS Citrus sinensis cDNA clone VS27V10 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900094 ID=DC900094|Name=DC900094|organism=Citrus sinensis|type=EST|length=552bp
TTGATGTTGTCTTTGCTGGCCATGTCCATGCTTATGAAAGATCGTATCGA
ATCTCGAATCTACACTACAACATATCAAGTGGTGACTGTTTCCCTGTGCC
AGATATCCACAGCCAGATTATTCTGCCTTTCGAGAAGCCAGTTATGGGCA
CTCTACACTAGAGATTAAAAACAGGACACATGCATTCTACCACTGGAACC
GCAATGATGATGGGAAAAAAGTGGCAACGGACTCATTCATATTGCACAAT
CAGTACTGGGCAAGCAACCGTAGGAGGAGAAAACTGAACAAGCACTATTT
AAGAAGCGTTGTTGGCGAGCTTTTTGCTTAACTAGGAGGTATCTAGAGAG
TCTCCGATATATATATGGTCGATTGGATACAAACTCACGGGGGATTTCAG
TCAAATTCTTCAACTTGTATGATTACGCCGCATACAATTCATCCCTTATT
TGTCATGTTGTAGACCTGTAGTATATTTCAATAAGAATCAATATGTTGTA
ACAATATTTGCAAGCTACATTGACATATATGGAGAAATGCCACGTTACAT
AT
back to top