DC900089

Overview
NameDC900089
Unique NameDC900089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length899
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10082 contig Csv1_Contig10082:504..1401. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: Y4KL_RHISN (Uncharacterized AAA family ATPase y4kL OS=Rhizobium sp. (strain NGR234) GN=NGR_a02840 PE=3 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.074e-17
Identity = 70/222 (31.53%), Postives = 104/222 (46.85%), Query Frame = 3
Query:   48 GIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSA 713
            G+K    +L  GPPG GKTL A   A+ +     +V    +I  Y+GE+A  IR+ F +AR  QPC++F DE DA+   R   G     E++R +  LL  +D     G   +I ATN    LD A+ R  R D  +    P        LK+    +      D        EG++ A++  VCT+A  + I   R  V   DF +A++  +EA++    A
Sbjct:  114 GLKVRSKMLFCGPPGCGKTLCAEIFAAELGLPLFRVKLDRLISSYLGETATNIRKTFEFAR-KQPCVLFFDEFDALARTRDDSG--EHNELRRVVNSLLLFIDNMQPKG--FLIAATNLDRSLDAAIWR--RFDEVLWFDRPEAAMIGRFLKLKFKNVPV--AFDPARNSAALEGYSFAEIERVCTQAIKAMIIERRKQVQERDFNRALQ--DEARRRAGQA 324          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: YJOB_BACSU (Uncharacterized ATPase yjoB OS=Bacillus subtilis GN=yjoB PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.403e-17
Identity = 68/178 (38.20%), Postives = 97/178 (54.49%), Query Frame = 3
Query:   63 KGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALL-RPGRLDRKIEIPLPNEQSRMEILKIHAAGI-AKHGEIDYEAVVKLAEGFNGADL 590
            +G+LLYGPPG GKT L ++IA +IDA     V+   I ++   S+  I E+F  AR   P ++ +++ID++             E  R+    LN LDG      + +I  TN P+ +DP L+ R GR DR  EI LP+E+ R+E +K+   GI    GEI   A  KL EGF+ A L
Sbjct:  221 RGILLYGPPGNGKTTLVKSIAGSIDA----PVAYWQITEF--TSSETIEEVFQAARRLAPAVLVIEDIDSM------------PEDVRSF--FLNTLDGATSKEGLFLIGTTNYPEEIDPGLMNRAGRFDRAYEIGLPDEELRLEYMKMRGFGIFLSEGEIKNAA--KLTEGFSFAQL 376          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: YCF46_PORPU (Uncharacterized AAA domain-containing protein ycf46 OS=Porphyra purpurea GN=ycf46 PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.832e-17
Identity = 62/202 (30.69%), Postives = 99/202 (49.01%), Query Frame = 3
Query:   48 GIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTS-ADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDY--EAVVKLAEGFNGADLRNVCTEAGMSAIRAERDY 644
            GI  PKG+LL G  GTGK+L A+AIA++     L++    +    +GES   +REM   A    PC++++DEID      +S+G S     +  T +  L+     ++   V ++   N    L   +LR GR D    + LPN + R  I +IH A I      +Y  + +  L   F+GA++     E+  +A   ER++
Sbjct:  255 GIPTPKGLLLVGIQGTGKSLTAKAIANDWTLPLLRLDIGKLFGGLVGESESRMREMVTIAEGLSPCVLWIDEIDKAFSNLYSQGDSGTSARVFGTFITWLS-----EKTTPVFVVATANTIQNLPSEMLRKGRFDEIFFLDLPNNEERELIFQIHLARIRPKSWQNYNIKQLSLLCNKFSGAEIEQAIVESMHTAFSEEREF 451          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: YCF46_GRATL (Uncharacterized AAA domain-containing protein ycf46 OS=Gracilaria tenuistipitata var. liui GN=ycf46 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.646e-16
Identity = 64/211 (30.33%), Postives = 103/211 (48.82%), Query Frame = 3
Query:   48 GIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGI--AKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAV 674
            G+  PKG+LL G  GTGK+L+A+AI+   +   LK+    I    +G+S   +R M   A    PCI+++DEID    R  +   S      R L  +L  L   ++   V +I   N+   L   LLR GR D    + LP+ + R +I +IH          + D + + KL + F+GA++     EA  +A   +R++   +D + A+
Sbjct:  256 GLTVPKGILLIGIQGTGKSLIAKAISGQWNLPLLKLDMGKIFASLVGQSEERMRHMIKTAEQSSPCILWIDEIDKCFTRLNNYTDSGTN--GRVLSTMLTWLS--EKKKPVFVIATANQVLSLPSELLRKGRFDEIFFLNLPSLEEREKIFQIHLMKFRPLSWRKYDIKYLSKLTDQFSGAEIEQAIIEAMYNAFYEKREFST-QDIINAI 461          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: FTSH_OLTVI (Cell division protease ftsH homolog OS=Oltmannsiellopsis viridis GN=ftsH PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.477e-14
Identity = 43/116 (37.07%), Postives = 69/116 (59.48%), Query Frame = 3
Query:  291 SEGTSADREIQRT----LMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAI 626
            S  +S + E+++     L+ LL ++DG + L  V +  ATNRP+VLDPAL+RPGR D+ + I LP +Q R+EILK++A  +     I +E       G + ADL  +  ++ + A+
Sbjct: 1487 SHESSNEMEVEKNQLSALIRLLVEMDGLNPLNGVIVFGATNRPEVLDPALIRPGRFDQILPIELPGKQKRVEILKLYAKKLGTAKSISWEYFANRTVGLSAADLAAIMNQSTILAV 1602          

HSP 2 Score: 70.0922 bits (170), Expect = 1.962e-11
Identity = 39/79 (49.37%), Postives = 52/79 (65.82%), Query Frame = 3
Query:   60 PKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGES---ARLIREMFGYARDHQPCIIFMDEIDAIGGRR 287
            PKG+LL GPPGTGKTLL +AIA   +AN   +V S  +    GES   A  + ++F  AR+  PCI+F+DEID +G +R
Sbjct: 1334 PKGILLVGPPGTGKTLLVQAIAG--EANVPVLVQSLSLISQPGESDSGAEKLTDLFKRARELSPCIVFIDEIDTLGIKR 1410          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: FTSH_CHLVU (Cell division protease ftsH homolog OS=Chlorella vulgaris GN=ftsH PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 4.671e-13
Identity = 43/121 (35.54%), Postives = 69/121 (57.02%), Query Frame = 3
Query:  291 SEGTSADREIQRTLM-ELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVI 650
            +E  S   E Q +L+ +LL +LDG      V +  ATNRP+VLDPALLRPGR D+ +++ LP ++ R+EIL+ +   +     + +    +   GF  ADL  +  E+ + AI  + ++ I
Sbjct: 1141 AEYNSKQNEKQVSLLSQLLIELDGIQGRNGVVIFGATNRPEVLDPALLRPGRFDKIVKVGLPAQKKRVEILQFYGQTLGYQKTMPWAYFGERTVGFTAADLATLMNESALKAILNQSNHTI 1261          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: ATD3B_HUMAN (ATPase family AAA domain-containing protein 3B OS=Homo sapiens GN=ATAD3B PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 8.808e-12
Identity = 57/217 (26.27%), Postives = 102/217 (47.00%), Query Frame = 3
Query:   69 VLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYAR-DHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIA-----------KHGEIDY----EAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKA 671
            +LLYGPPGTGKTL A+ +A +   ++  +++   +     E    + ++F +A    +  ++FMDE DA   +R +E  S D  ++ TL   L  +       K  +++A+N P+  D A+    R+D  +   LP ++ R  ++++H                K  + DY      V +L EG +G ++  +      +A  A +D V+ E  M A
Sbjct:  348 ILLYGPPGTGKTLFAKKLALHSGMDY-AIMTGGDVAPMGREGVTAMHKLFDWANTSRRGLLLFMDEADAFLRKRATEEISKD--LRATLNAFLYHMG--QHSNKFMLVLASNLPEQFDCAI--NSRIDVMVHFDLPQQEERERLVRLHFDNCVLKPATEGKRRLKLAQFDYGRKCSEVARLTEGMSGREIAQLAVSWQATAY-ASKDGVLTEAMMDA 556          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: BCS1_YEAST (Mitochondrial chaperone BCS1 OS=Saccharomyces cerevisiae GN=BCS1 PE=1 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 1.150e-11
Identity = 46/139 (33.09%), Postives = 67/139 (48.20%), Query Frame = 3
Query:   48 GIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQP--CIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKI 458
            GI   +G LLYGPPG+GKT   +A+A  +D N   +  S            L  +   +  ++ P   I+ +++IDA   +R   G         T   LLN LDG     +    M TN P+ LD A++RPGR+D K+
Sbjct:  256 GIPYRRGYLLYGPPGSGKTSFIQALAGELDYNICILNLS---------ENNLTDDRLNHLMNNMPERSILLLEDIDAAFNKRSQTGEQGFHS-SVTFSGLLNALDGVTSSEETITFMTTNHPEKLDAAIMRPGRIDYKV 384          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: YCX1_OSTTA (Uncharacterized protein OtCpg00170 OS=Ostreococcus tauri GN=OtCpg00170 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.709e-11
Identity = 61/219 (27.85%), Postives = 100/219 (45.66%), Query Frame = 3
Query:   60 PKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGF-------DQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEI--PLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNE 689
            PKG+LL G PG G++ LARAIAS       K  S+  +D   G     +  +F   RD  P I+F+ +ID I   R  E T++   IQ T  + L   DG+           K+  + + +    +DPA LR GR +  + +  P+  E+  + + K   + +     I +     ++EGF  A++ ++   + + AIR         +F+     LNE
Sbjct:  765 PKGMLLVGDPGNGRSFLARAIASESRLPVFKTESTRFLDVKFG--VMRLMSLFRRVRDQAPGILFIRDIDLITIDR--ERTNSPELIQLT-TQFLICFDGYYIGSEARPTQRKIFTLGSVSDITRMDPACLRSGRFEWVVNLRKPILGERKFLLLQKASQSPVQIDATIAWNYFGLMSEGFTNAEVVSIVNNSTLQAIR-------KNEFVHTNESLNE 971          
The following BLAST results are available for this feature:
BLAST of DC900089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 389
Match NameE-valueIdentityDescription
Y4KL_RHISN1.074e-1731.53Uncharacterized AAA family ATPase y4kL OS=Rhizobiu... [more]
YJOB_BACSU1.403e-1738.20Uncharacterized ATPase yjoB OS=Bacillus subtilis G... [more]
YCF46_PORPU1.832e-1730.69Uncharacterized AAA domain-containing protein ycf4... [more]
YCF46_GRATL2.646e-1630.33Uncharacterized AAA domain-containing protein ycf4... [more]
FTSH_OLTVI2.477e-1437.07Cell division protease ftsH homolog OS=Oltmannsiel... [more]
FTSH_CHLVU4.671e-1335.54Cell division protease ftsH homolog OS=Chlorella v... [more]
ATD3B_HUMAN8.808e-1226.27ATPase family AAA domain-containing protein 3B OS=... [more]
BCS1_YEAST1.150e-1133.09Mitochondrial chaperone BCS1 OS=Saccharomyces cere... [more]
YCX1_OSTTA5.709e-1127.85Uncharacterized protein OtCpg00170 OS=Ostreococcus... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900089 VSS Citrus sinensis cDNA clone VS27V05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900089 ID=DC900089|Name=DC900089|organism=Citrus sinensis|type=EST|length=899bp
AATCTATTGAGCTACCTTTGATGAATCCTGAGCTTTTCCTTAGAGTTGGA
ATTAAACCTCCCAAGGGCGTTCTTCTTTATGGGCCTCCTGGAACTGGCAA
GACATTATTAGCACGAGCAATTGCCAGTAACATAGATGCAAATTTTCTGA
AGGTTGTTTCAAGTGCCATTATTGATAAGTACATTGGGGAAAGTGCAAGG
TTGATAAGAGAGATGTTTGGATACGCACGCGATCATCAACCCTGCATCAT
TTTTATGGATGAAATTGATGCCATCGGTGGGCGCCGTTTTAGTGAAGGAA
CCAGTGCAGATCGTGAAATTCAAAGGACACTGATGGAGTTACTTAATCAG
CTTGATGGATTTGATCAGCTTGGGAAGGTTAAAATGATAATGGCCACTAA
CAGACCTGATGTCCTTGACCCTGCACTTCTTCGTCCAGGGCGACTGGATA
GGAAAATTGAGATTCCATTGCCAAATGAGCAGTCAAGAATGGAAATTCTT
AAAATTCATGCTGCTGGCATTGCTAAGCATGGCGAGATTGATTATGAGGC
TGTTGTGAAGCTTGCAGAGGGCTTTAATGGGGCTGATCTCCGAAATGTTT
GCACCGAGGCTGGAATGTCGGCAATCCGTGCTGAACGTGATTATGTCATC
CACGAAGATTTTATGAAGGCTGTCCGGAAACTGAATGAGGCAAAGAAACT
TGAATCAAGTGCTCACTACAATGCTGATTTTGGAAAAGAGTAAAAACATT
TAGGAAAAGAGCCAAGGATCTTGAGGCAGTGCGGTTATTTTTCAGATGTA
ATTGTTTTCATATTTTTGTTAAAACATCTTGCTTTAATTTGTGAAGTTAG
TGGTTCTTTGAGCGATGGAATGCTNTATATATTAAACAATCATTCACGT
back to top