DC900089

Overview
NameDC900089
Unique NameDC900089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length899
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10082 contig Csv1_Contig10082:504..1401. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS8_HUMAN (26S protease regulatory subunit 8 OS=Homo sapiens GN=PSMC5 PE=1 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 3.519e-69
Identity = 128/226 (56.64%), Postives = 168/226 (74.34%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            IELP+ +PELF  +GI  PKGVLLYGPPGTGKTLLARA+A + D  F++V  S ++ K+IGE AR++RE+F  AR+H P IIFMDEID+IG  R   G+  D E+QRT++ELLNQLDGF+    +K+IMATNR D+LD ALLRPGR+DRKIE P PNE++R++ILKIH+  +     I+   + +L  G +GA+++ VCTEAGM A+R  R +V  EDF  AV K+
Sbjct:  165 IELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKV 390          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS8_BOVIN (26S protease regulatory subunit 8 OS=Bos taurus GN=PSMC5 PE=2 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 3.519e-69
Identity = 128/226 (56.64%), Postives = 168/226 (74.34%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            IELP+ +PELF  +GI  PKGVLLYGPPGTGKTLLARA+A + D  F++V  S ++ K+IGE AR++RE+F  AR+H P IIFMDEID+IG  R   G+  D E+QRT++ELLNQLDGF+    +K+IMATNR D+LD ALLRPGR+DRKIE P PNE++R++ILKIH+  +     I+   + +L  G +GA+++ VCTEAGM A+R  R +V  EDF  AV K+
Sbjct:  165 IELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKV 390          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS8B_ARATH (26S protease regulatory subunit 8 homolog B OS=Arabidopsis thaliana GN=RPT6B PE=2 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 3.519e-69
Identity = 130/227 (57.27%), Postives = 169/227 (74.45%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGT-SADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            IELP+ +PELF  +GI  PKGVLLYGPPGTGKTLLARA+A + D  F++V  S ++ KYIGE +R++RE+F  AR+H P IIFMDEID+IG  R   G+ + D E+QRT++ELLNQLDGF+   K+K++MATNR D+LD ALLRPGR+DRKIE P PNE+SR +ILKIH+  +     ID + + +   G +GA+L+ VCTEAGM A+R  R +V  EDF  AV K+
Sbjct:  177 IELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKV 403          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS8A_ARATH (26S protease regulatory subunit 8 homolog A OS=Arabidopsis thaliana GN=RPT6A PE=2 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 3.519e-69
Identity = 130/227 (57.27%), Postives = 169/227 (74.45%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGT-SADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            IELP+ +PELF  +GI  PKGVLLYGPPGTGKTLLARA+A + D  F++V  S ++ KYIGE +R++RE+F  AR+H P IIFMDEID+IG  R   G+ + D E+QRT++ELLNQLDGF+   K+K++MATNR D+LD ALLRPGR+DRKIE P PNE+SR +ILKIH+  +     ID + + +   G +GA+L+ VCTEAGM A+R  R +V  EDF  AV K+
Sbjct:  177 IELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKV 403          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS8_ENCCU (26S protease regulatory subunit 8 homolog OS=Encephalitozoon cuniculi GN=RPT6 PE=1 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 6.002e-69
Identity = 133/244 (54.51%), Postives = 171/244 (70.08%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYNADFGK 737
            IELP+ +PELF  +GI  PKGVLLYGPPGTGKTLLARA+A +    F++V  S ++ KYIGE +RL+RE+F  AR+H P IIFMDEID+IG  R      +D E+QRT++ELLNQLDGF+    +K+IMATNR D+LDPALLR GR+DRKIE P PNE +R+EILKIH+  +     ID E +     G +GA+++ VCTEAGM A+R  R +V  EDF  AV K+     L+ +   N+D  K
Sbjct:  212 IELPIKHPELFENLGIAQPKGVLLYGPPGTGKTLLARAVAHHTQCKFIRVSGSELVQKYIGEGSRLVRELFIMAREHAPSIIFMDEIDSIGSTRGDSNKGSDSEVQRTMLELLNQLDGFESHNNIKVIMATNRIDILDPALLRTGRIDRKIEFPPPNESARLEILKIHSRKMNLTKGIDLETIASKMVGCSGAEVKAVCTEAGMYALRERRVHVTQEDFEMAVHKV-----LKKTGDLNSDLRK 450          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_METMA (Proteasome-activating nucleotidase OS=Methanosarcina mazei GN=pan PE=3 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 1.024e-68
Identity = 122/230 (53.04%), Postives = 175/230 (76.09%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEA 692
            ++ELPL +PE F R+GI+PPKGVLLYG PGTGKTLLA+A+A   +A F++VV S ++ KYIG+ ++L+RE+F  AR   P IIF+DE+D+I  RR +E T ADRE+QRTLM+LL ++DGFD+   +++I ATNRPDVLDPA+LRPGR DR + +P+P  ++R +ILKIH   +    +ID++ + K  EG +GADL+ + TEAGM A+R +++ V  E+F++AV K++ A
Sbjct:  174 AVELPLTSPERFARIGIEPPKGVLLYGLPGTGKTLLAKAVAHRTNATFIRVVGSELVQKYIGDGSKLVREIFEMARKKAPSIIFIDELDSIAARRLNETTGADREVQRTLMQLLAEMDGFDKRKNIRIIAATNRPDVLDPAILRPGRFDRLVHVPMPGIEARGKILKIHCEKMTLAEDIDFKKLAKATEGMSGADLKAIATEAGMFAVRRDKELVEMEEFLEAVEKVSMA 403          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS8_SCHPO (26S protease regulatory subunit 8 homolog OS=Schizosaccharomyces pombe GN=let1 PE=2 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 1.337e-68
Identity = 133/237 (56.12%), Postives = 173/237 (73.00%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRF-SEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRK-LNEAKKLESS 710
            IELP+ +PELF  +GI  PKG+LLYGPPGTGKTLLARA+A + D  F++V  S ++ KYIGE +R++RE+F  AR+H P IIFMDEID+IG  R  S G S D E+QRT++ELLNQLDGF+    +K+IMATNR D+LDPALLRPGR+DRKIE P P+ ++R EIL+IH+  +     ID +++ +   G +GA+L+ VCTEAGM A+R  R +V  EDF  AV K LN+    E S
Sbjct:  161 IELPVKHPELFESLGIPQPKGILLYGPPGTGKTLLARAVAHHTDCKFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRSDSSGGSGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPSAEARAEILRIHSRSMNLTRGIDLKSIAEKMNGASGAELKGVCTEAGMFALRERRVHVTQEDFELAVAKVLNKGDSGEMS 397          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_SULSO (Proteasome-activating nucleotidase OS=Sulfolobus solfataricus GN=pan PE=3 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 2.281e-68
Identity = 129/235 (54.89%), Postives = 172/235 (73.19%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLN-EAKKLES 707
            +ELPL NPE+F  +G++PPKGVLLYGPPGTGKT+LA+A+A+  +A F+ VV+S    K++GE AR++RE+F  A+   P IIF+DEIDAIG +R   GTS +REIQRTLM+LL +LDGFD L  VK+I ATNR D+LDPALLRPGR DR IE+PLP+ + R EI  I+   +     I+ E + +L EGF+GAD++NVC EA   AIR  R+ V   D ++A+ K+N +  K+ES
Sbjct:  150 VELPLKNPEIFREIGVEPPKGVLLYGPPGTGKTMLAKAVATESNAVFIHVVASEFAQKFVGEGARIVRELFEMAKRKAPSIIFIDEIDAIGAKRIDIGTSGEREIQRTLMQLLAELDGFDPLDNVKIIAATNRIDILDPALLRPGRFDRIIEVPLPDFKGRTEIFNIYLKKMKIEDNINLELLSQLTEGFSGADIKNVCVEAAYMAIRDGRNKVTMNDLVEAINKINVKRNKMES 384          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS4_RAT (26S protease regulatory subunit 4 OS=Rattus norvegicus GN=Psmc1 PE=2 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 2.979e-68
Identity = 119/223 (53.36%), Postives = 168/223 (75.34%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKA 671
            S+ELPL +PE +  +GIKPPKGV+LYGPPGTGKTLLA+A+A+   A FL+VV S +I KY+G+  +L+RE+F  A +H P I+F+DEIDAIG +R+   +  +REIQRT++ELLNQLDGFD  G VK+IMATNR + LDPAL+RPGR+DRKIE PLP+E+++  I +IH + +    ++  + ++   +  +GAD++ +CTEAG+ A+R  R  V +EDF K+
Sbjct:  200 SVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKS 422          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS4_MOUSE (26S protease regulatory subunit 4 OS=Mus musculus GN=Psmc1 PE=1 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 2.979e-68
Identity = 119/223 (53.36%), Postives = 168/223 (75.34%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKA 671
            S+ELPL +PE +  +GIKPPKGV+LYGPPGTGKTLLA+A+A+   A FL+VV S +I KY+G+  +L+RE+F  A +H P I+F+DEIDAIG +R+   +  +REIQRT++ELLNQLDGFD  G VK+IMATNR + LDPAL+RPGR+DRKIE PLP+E+++  I +IH + +    ++  + ++   +  +GAD++ +CTEAG+ A+R  R  V +EDF K+
Sbjct:  200 SVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKS 422          
The following BLAST results are available for this feature:
BLAST of DC900089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 389
Match NameE-valueIdentityDescription
PRS8_HUMAN3.519e-6956.6426S protease regulatory subunit 8 OS=Homo sapiens ... [more]
PRS8_BOVIN3.519e-6956.6426S protease regulatory subunit 8 OS=Bos taurus GN... [more]
PRS8B_ARATH3.519e-6957.2726S protease regulatory subunit 8 homolog B OS=Ara... [more]
PRS8A_ARATH3.519e-6957.2726S protease regulatory subunit 8 homolog A OS=Ara... [more]
PRS8_ENCCU6.002e-6954.5126S protease regulatory subunit 8 homolog OS=Encep... [more]
PSMR_METMA1.024e-6853.04Proteasome-activating nucleotidase OS=Methanosarci... [more]
PRS8_SCHPO1.337e-6856.1226S protease regulatory subunit 8 homolog OS=Schiz... [more]
PSMR_SULSO2.281e-6854.89Proteasome-activating nucleotidase OS=Sulfolobus s... [more]
PRS4_RAT2.979e-6853.3626S protease regulatory subunit 4 OS=Rattus norveg... [more]
PRS4_MOUSE2.979e-6853.3626S protease regulatory subunit 4 OS=Mus musculus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900089 VSS Citrus sinensis cDNA clone VS27V05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900089 ID=DC900089|Name=DC900089|organism=Citrus sinensis|type=EST|length=899bp
AATCTATTGAGCTACCTTTGATGAATCCTGAGCTTTTCCTTAGAGTTGGA
ATTAAACCTCCCAAGGGCGTTCTTCTTTATGGGCCTCCTGGAACTGGCAA
GACATTATTAGCACGAGCAATTGCCAGTAACATAGATGCAAATTTTCTGA
AGGTTGTTTCAAGTGCCATTATTGATAAGTACATTGGGGAAAGTGCAAGG
TTGATAAGAGAGATGTTTGGATACGCACGCGATCATCAACCCTGCATCAT
TTTTATGGATGAAATTGATGCCATCGGTGGGCGCCGTTTTAGTGAAGGAA
CCAGTGCAGATCGTGAAATTCAAAGGACACTGATGGAGTTACTTAATCAG
CTTGATGGATTTGATCAGCTTGGGAAGGTTAAAATGATAATGGCCACTAA
CAGACCTGATGTCCTTGACCCTGCACTTCTTCGTCCAGGGCGACTGGATA
GGAAAATTGAGATTCCATTGCCAAATGAGCAGTCAAGAATGGAAATTCTT
AAAATTCATGCTGCTGGCATTGCTAAGCATGGCGAGATTGATTATGAGGC
TGTTGTGAAGCTTGCAGAGGGCTTTAATGGGGCTGATCTCCGAAATGTTT
GCACCGAGGCTGGAATGTCGGCAATCCGTGCTGAACGTGATTATGTCATC
CACGAAGATTTTATGAAGGCTGTCCGGAAACTGAATGAGGCAAAGAAACT
TGAATCAAGTGCTCACTACAATGCTGATTTTGGAAAAGAGTAAAAACATT
TAGGAAAAGAGCCAAGGATCTTGAGGCAGTGCGGTTATTTTTCAGATGTA
ATTGTTTTCATATTTTTGTTAAAACATCTTGCTTTAATTTGTGAAGTTAG
TGGTTCTTTGAGCGATGGAATGCTNTATATATTAAACAATCATTCACGT
back to top