DC900089

Overview
NameDC900089
Unique NameDC900089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length899
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10082 contig Csv1_Contig10082:504..1401. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_SULIN (Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=pan PE=3 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 9.582e-67
Identity = 124/227 (54.63%), Postives = 167/227 (73.57%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLN 686
            +ELPL  PE+F  +G++PPKGVLLYGPPGTGKT+LA+A+A+  +A F+ VV+S    K++GE AR++RE+F  A+   P IIF+DEIDAIG +R   GTS +REIQRTLM+LL +LDGF+ L  VK+I ATNR D+LDPALLRPGR DR IE+PLP+ + R EI  I+   +     I+ E + +L+EGF+GAD++NVC EA   AIR  R+ V  +D + A+ K+N
Sbjct:  150 VELPLKKPEIFREIGVEPPKGVLLYGPPGTGKTMLAKAVATESNAVFIHVVASEFAQKFVGEGARIVRELFEMAKRKAPSIIFIDEIDAIGAKRIDIGTSGEREIQRTLMQLLAELDGFNPLDNVKIIAATNRIDILDPALLRPGRFDRIIEVPLPDFRGRTEIFNIYLKKMKVEDNINLELLSQLSEGFSGADIKNVCVEAAYMAIRDGRNKVTMKDLVNAITKIN 376          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS6A_ENCCU (26S protease regulatory subunit 6A OS=Encephalitozoon cuniculi GN=RPT5 PE=1 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 9.582e-67
Identity = 122/232 (52.59%), Postives = 166/232 (71.55%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKK 698
            +I L L +PE F ++ IKPPKGVL+YGPPGTGKTL+ARA AS  +A FLK+    ++  YIG+ ARL+R+ F  A++ +P IIF+DEIDAIG +R     + DRE+QRT++ELLNQLDGF    +VK+I ATNR D+LDPALLR GRLDRKIE PLPN   R  IL+IHA  ++   +++++ + +  EGFNGA  + VC EAGM+A+R E+  +   DFM  ++++   KK
Sbjct:  163 AIVLSLTHPERFEKLNIKPPKGVLMYGPPGTGKTLMARACASKTNATFLKLAGPQLVQMYIGDGARLVRDAFALAKERKPTIIFIDEIDAIGAKRSDSDQTGDREVQRTMLELLNQLDGFSSSEEVKIIAATNRVDILDPALLRSGRLDRKIEFPLPNTLGRKRILQIHARKMSVRDDVNFDELARSTEGFNGAQCKAVCVEAGMAALRKEKTEISQNDFMDGIQEVLSRKK 394          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_SULIY (Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=pan PE=3 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 1.251e-66
Identity = 124/227 (54.63%), Postives = 167/227 (73.57%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLN 686
            +ELPL  PE+F  +G++PPKGVLLYGPPGTGKT+LA+A+A+  +A F+ VV+S    K++GE AR++RE+F  A+   P IIF+DEIDAIG +R   GTS +REIQRTLM+LL +LDGF+ L  VK+I ATNR D+LDPALLRPGR DR IE+PLP+ + R EI  I+   +     I+ E + +L+EGF+GAD++NVC EA   AIR  R+ V  +D + A+ K+N
Sbjct:  150 VELPLKKPEIFREIGVEPPKGVLLYGPPGTGKTMLAKAVATESNAVFIHVVASEFAQKFVGEGARIVRELFEMAKRKAPSIIFIDEIDAIGAKRIDIGTSGEREIQRTLMQLLAELDGFNPLDNVKIIAATNRIDILDPALLRPGRFDRIIEVPLPDFRGRTEIFNIYLKKMKVEDNINLELLSQLSEGFSGADIKNVCVEAAYMAIRDGRNKVTMKDLVDAITKIN 376          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_SULIM (Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=pan PE=3 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 1.251e-66
Identity = 124/227 (54.63%), Postives = 167/227 (73.57%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLN 686
            +ELPL  PE+F  +G++PPKGVLLYGPPGTGKT+LA+A+A+  +A F+ VV+S    K++GE AR++RE+F  A+   P IIF+DEIDAIG +R   GTS +REIQRTLM+LL +LDGF+ L  VK+I ATNR D+LDPALLRPGR DR IE+PLP+ + R EI  I+   +     I+ E + +L+EGF+GAD++NVC EA   AIR  R+ V  +D + A+ K+N
Sbjct:  150 VELPLKKPEIFREIGVEPPKGVLLYGPPGTGKTMLAKAVATESNAVFIHVVASEFAQKFVGEGARIVRELFEMAKRKAPSIIFIDEIDAIGAKRIDIGTSGEREIQRTLMQLLAELDGFNPLDNVKIIAATNRIDILDPALLRPGRFDRIIEVPLPDFRGRTEIFNIYLKKMKVEDNINLELLSQLSEGFSGADIKNVCVEAAYMAIRDGRNKVTMKDLVDAITKIN 376          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_SULIL (Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=pan PE=3 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 1.251e-66
Identity = 124/227 (54.63%), Postives = 167/227 (73.57%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLN 686
            +ELPL  PE+F  +G++PPKGVLLYGPPGTGKT+LA+A+A+  +A F+ VV+S    K++GE AR++RE+F  A+   P IIF+DEIDAIG +R   GTS +REIQRTLM+LL +LDGF+ L  VK+I ATNR D+LDPALLRPGR DR IE+PLP+ + R EI  I+   +     I+ E + +L+EGF+GAD++NVC EA   AIR  R+ V  +D + A+ K+N
Sbjct:  150 VELPLKKPEIFREIGVEPPKGVLLYGPPGTGKTMLAKAVATESNAVFIHVVASEFAQKFVGEGARIVRELFEMAKRKAPSIIFIDEIDAIGAKRIDIGTSGEREIQRTLMQLLAELDGFNPLDNVKIIAATNRIDILDPALLRPGRFDRIIEVPLPDFRGRTEIFNIYLKKMKVEDNINLELLSQLSEGFSGADIKNVCVEAAYMAIRDGRNKVTMKDLVDAITKIN 376          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_SULIK (Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=pan PE=3 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 1.251e-66
Identity = 124/227 (54.63%), Postives = 167/227 (73.57%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLN 686
            +ELPL  PE+F  +G++PPKGVLLYGPPGTGKT+LA+A+A+  +A F+ VV+S    K++GE AR++RE+F  A+   P IIF+DEIDAIG +R   GTS +REIQRTLM+LL +LDGF+ L  VK+I ATNR D+LDPALLRPGR DR IE+PLP+ + R EI  I+   +     I+ E + +L+EGF+GAD++NVC EA   AIR  R+ V  +D + A+ K+N
Sbjct:  150 VELPLKKPEIFREIGVEPPKGVLLYGPPGTGKTMLAKAVATESNAVFIHVVASEFAQKFVGEGARIVRELFEMAKRKAPSIIFIDEIDAIGAKRIDIGTSGEREIQRTLMQLLAELDGFNPLDNVKIIAATNRIDILDPALLRPGRFDRIIEVPLPDFRGRTEIFNIYLKKMKVEDNINLELLSQLSEGFSGADIKNVCVEAAYMAIRDGRNKVTMKDLVDAITKIN 376          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_SULIA (Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.16.27) GN=pan PE=3 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 1.251e-66
Identity = 124/227 (54.63%), Postives = 167/227 (73.57%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLN 686
            +ELPL  PE+F  +G++PPKGVLLYGPPGTGKT+LA+A+A+  +A F+ VV+S    K++GE AR++RE+F  A+   P IIF+DEIDAIG +R   GTS +REIQRTLM+LL +LDGF+ L  VK+I ATNR D+LDPALLRPGR DR IE+PLP+ + R EI  I+   +     I+ E + +L+EGF+GAD++NVC EA   AIR  R+ V  +D + A+ K+N
Sbjct:  150 VELPLKKPEIFREIGVEPPKGVLLYGPPGTGKTMLAKAVATESNAVFIHVVASEFAQKFVGEGARIVRELFEMAKRKAPSIIFIDEIDAIGAKRIDIGTSGEREIQRTLMQLLAELDGFNPLDNVKIIAATNRIDILDPALLRPGRFDRIIEVPLPDFRGRTEIFNIYLKKMKVEDNINLELLSQLSEGFSGADIKNVCVEAAYMAIRDGRNKVTMKDLVDAITKIN 376          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_METHJ (Proteasome-activating nucleotidase OS=Methanospirillum hungatei (strain JF-1 / DSM 864) GN=pan PE=3 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 1.251e-66
Identity = 127/226 (56.19%), Postives = 160/226 (70.80%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRK 680
            ++ELP+  P+LF ++GI PPKGVLLYGPPGTGKTLLA+A+A    A FL  V S ++ KYIGE ARL+RE+F  A++  P I+F+DEIDAIG  R    TS DRE+QRTLM+LL  +DGF+  G VK+I ATNR D+LD ALLRPGR DR IEIPLP+ + R  ILK+H   +    ++D   V +L EG NGA+L  +C EAGM AIR E   V  EDF+ A+ K
Sbjct:  168 AVELPMTRPDLFEKIGINPPKGVLLYGPPGTGKTLLAKAVAHETHAIFLHTVGSELVQKYIGEGARLVRELFDLAKEKAPSIVFIDEIDAIGASRTEAMTSGDREVQRTLMQLLAAMDGFEPRGDVKIIGATNRIDILDAALLRPGRFDRIIEIPLPDTEGRYSILKVHTRCMNLSEDVDLMEVARLTEGRNGAELNAICMEAGMFAIRKEHPQVDQEDFLTALNK 393          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PS6AA_ARATH (26S protease regulatory subunit 6A homolog A OS=Arabidopsis thaliana GN=RPT5A PE=2 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 1.251e-66
Identity = 122/239 (51.05%), Postives = 173/239 (72.38%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHY 719
            +I LP+ + E F ++G++PPKGVLLYGPPGTGKTL+ARA A+  +A FLK+    ++  +IG+ A+L+R+ F  A++  PCIIF+DEIDAIG +RF    S DRE+QRT++ELLNQLDGF    ++K+I ATNR D+LDPAL+R GRLDRKIE P P E++R  IL+IH+  +  H ++++E + +  + FNGA L+ VC EAGM A+R +   V HEDF + + ++ +AKK  S  +Y
Sbjct:  186 AIVLPMTHKERFEKLGVRPPKGVLLYGPPGTGKTLMARACAAQTNATFLKLAGPQLVQMFIGDGAKLVRDAFQLAKEKAPCIIFIDEIDAIGTKRFDSEVSGDREVQRTMLELLNQLDGFSSDERIKVIAATNRADILDPALMRSGRLDRKIEFPHPTEEARARILQIHSRKMNVHPDVNFEELARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQV-QAKKKASLNYY 423          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS6A_BRACM (26S protease regulatory subunit 6A homolog OS=Brassica campestris GN=TBP1 PE=2 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 1.251e-66
Identity = 122/239 (51.05%), Postives = 173/239 (72.38%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHY 719
            +I LP+ + E F ++G++PPKGVLLYGPPGTGKTL+ARA A+  +A FLK+    ++  +IG+ A+L+R+ F  A++  PCIIF+DEIDAIG +RF    S DRE+QRT++ELLNQLDGF    ++K+I ATNR D+LDPAL+R GRLDRKIE P P E++R  IL+IH+  +  H ++++E + +  + FNGA L+ VC EAGM A+R +   V HEDF + + ++ +AKK  S  +Y
Sbjct:  186 AIVLPMTHKERFEKLGVRPPKGVLLYGPPGTGKTLMARACAAQTNATFLKLAGPQLVQMFIGDGAKLVRDAFQLAKEKAPCIIFIDEIDAIGTKRFDSEVSGDREVQRTMLELLNQLDGFSSDERIKVIAATNRADILDPALMRSGRLDRKIEFPHPTEEARARILQIHSRKMNVHPDVNFEELARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQV-QAKKKASLNYY 423          
The following BLAST results are available for this feature:
BLAST of DC900089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 389
Match NameE-valueIdentityDescription
PSMR_SULIN9.582e-6754.63Proteasome-activating nucleotidase OS=Sulfolobus i... [more]
PRS6A_ENCCU9.582e-6752.5926S protease regulatory subunit 6A OS=Encephalitoz... [more]
PSMR_SULIY1.251e-6654.63Proteasome-activating nucleotidase OS=Sulfolobus i... [more]
PSMR_SULIM1.251e-6654.63Proteasome-activating nucleotidase OS=Sulfolobus i... [more]
PSMR_SULIL1.251e-6654.63Proteasome-activating nucleotidase OS=Sulfolobus i... [more]
PSMR_SULIK1.251e-6654.63Proteasome-activating nucleotidase OS=Sulfolobus i... [more]
PSMR_SULIA1.251e-6654.63Proteasome-activating nucleotidase OS=Sulfolobus i... [more]
PSMR_METHJ1.251e-6656.19Proteasome-activating nucleotidase OS=Methanospiri... [more]
PS6AA_ARATH1.251e-6651.0526S protease regulatory subunit 6A homolog A OS=Ar... [more]
PRS6A_BRACM1.251e-6651.0526S protease regulatory subunit 6A homolog OS=Bras... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900089 VSS Citrus sinensis cDNA clone VS27V05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900089 ID=DC900089|Name=DC900089|organism=Citrus sinensis|type=EST|length=899bp
AATCTATTGAGCTACCTTTGATGAATCCTGAGCTTTTCCTTAGAGTTGGA
ATTAAACCTCCCAAGGGCGTTCTTCTTTATGGGCCTCCTGGAACTGGCAA
GACATTATTAGCACGAGCAATTGCCAGTAACATAGATGCAAATTTTCTGA
AGGTTGTTTCAAGTGCCATTATTGATAAGTACATTGGGGAAAGTGCAAGG
TTGATAAGAGAGATGTTTGGATACGCACGCGATCATCAACCCTGCATCAT
TTTTATGGATGAAATTGATGCCATCGGTGGGCGCCGTTTTAGTGAAGGAA
CCAGTGCAGATCGTGAAATTCAAAGGACACTGATGGAGTTACTTAATCAG
CTTGATGGATTTGATCAGCTTGGGAAGGTTAAAATGATAATGGCCACTAA
CAGACCTGATGTCCTTGACCCTGCACTTCTTCGTCCAGGGCGACTGGATA
GGAAAATTGAGATTCCATTGCCAAATGAGCAGTCAAGAATGGAAATTCTT
AAAATTCATGCTGCTGGCATTGCTAAGCATGGCGAGATTGATTATGAGGC
TGTTGTGAAGCTTGCAGAGGGCTTTAATGGGGCTGATCTCCGAAATGTTT
GCACCGAGGCTGGAATGTCGGCAATCCGTGCTGAACGTGATTATGTCATC
CACGAAGATTTTATGAAGGCTGTCCGGAAACTGAATGAGGCAAAGAAACT
TGAATCAAGTGCTCACTACAATGCTGATTTTGGAAAAGAGTAAAAACATT
TAGGAAAAGAGCCAAGGATCTTGAGGCAGTGCGGTTATTTTTCAGATGTA
ATTGTTTTCATATTTTTGTTAAAACATCTTGCTTTAATTTGTGAAGTTAG
TGGTTCTTTGAGCGATGGAATGCTNTATATATTAAACAATCATTCACGT
back to top