DC900089

Overview
NameDC900089
Unique NameDC900089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length899
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10082 contig Csv1_Contig10082:504..1401. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS6A_RAT (26S protease regulatory subunit 6A OS=Rattus norvegicus GN=Psmc3 PE=2 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 2.609e-64
Identity = 117/232 (50.43%), Postives = 165/232 (71.12%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKK 698
            +I LP+ + E F  +GI+PPKGVL+YGPPGTGKTLLARA A+   A FLK+    ++  +IG+ A+L+R+ F  A++  P IIF+DE+DAIG +RF    + DRE+QRT++ELLNQLDGF    +VK+I ATNR D+LDPALLR GRLDRKIE P+PNE++R  I++IH+  +    +++YE + +  + FNGA  + VC EAGM A+R     + HED+M+ + ++   KK
Sbjct:  201 AIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMEGILEVQAKKK 432          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS6A_HUMAN (26S protease regulatory subunit 6A OS=Homo sapiens GN=PSMC3 PE=1 SV=3)

HSP 1 Score: 245.743 bits (626), Expect = 2.609e-64
Identity = 117/232 (50.43%), Postives = 165/232 (71.12%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKK 698
            +I LP+ + E F  +GI+PPKGVL+YGPPGTGKTLLARA A+   A FLK+    ++  +IG+ A+L+R+ F  A++  P IIF+DE+DAIG +RF    + DRE+QRT++ELLNQLDGF    +VK+I ATNR D+LDPALLR GRLDRKIE P+PNE++R  I++IH+  +    +++YE + +  + FNGA  + VC EAGM A+R     + HED+M+ + ++   KK
Sbjct:  201 AIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMEGILEVQAKKK 432          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PR6AB_XENLA (26S protease regulatory subunit 6A-B OS=Xenopus laevis GN=psmc3-B PE=2 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 2.609e-64
Identity = 116/232 (50.00%), Postives = 165/232 (71.12%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKK 698
            +I LP+ + E F  +GI+PPKGVL+YGPPGTGKTLLARA A+   A FLK+    ++  +IG+ A+L+R+ F  A++  P IIF+DE+DAIG +RF    + DRE+QRT++ELLNQLDGF    +VK+I ATNR D+LDPALLR GRLDRKIE P+PNE++R  I++IH+  +    +++YE + +  + FNGA  + VC EAG+ A+R     + HED+M+ + ++   KK
Sbjct:  166 AIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFSLAKEKAPSIIFIDELDAIGNKRFDSEKAGDREVQRTMLELLNQLDGFQPTTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGIIALRRGATELTHEDYMEGILEVQAKKK 397          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS6B_MANSE (26S protease regulatory subunit 6B OS=Manduca sexta PE=2 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 4.451e-64
Identity = 122/239 (51.05%), Postives = 166/239 (69.46%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHY 719
            ++ELPL + EL+ ++GI+PP+GVL+YGPPG GKT+LA A+A +  A F++VV S  + KY+GE  R++R++F  A+++ P IIF+DEIDAI  +RF   T ADRE+QR L+ELLNQ+DGFDQ   VK+IMATNR D LDPALLRPGRLDRKIE PLP+ + +  I     A +    E+D E  V   +  +GAD+  +C EAGM+A+R  R  V+ +DF K  +  N  KK ES   +
Sbjct:  177 AVELPLTHVELYRQIGIEPPRGVLMYGPPGCGKTMLANAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITAKMNLSEEVDLEEFVARPDRVSGADINAICQEAGMNAVRENRYIVLPKDFEKGYK--NNIKKDESEYEF 413          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS6B_DICDI (26S protease regulatory subunit 6B homolog OS=Dictyostelium discoideum GN=psmC4 PE=1 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 9.916e-64
Identity = 118/225 (52.44%), Postives = 162/225 (72.00%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVR 677
            ++ELPL +  L+ ++GI PP+GVLLYGPPGTGKT+LA+A+A +  A F++VV S  + KY+GE  RL+R++F  AR++ P IIF+DEIDAI  +RF   T ADRE+QR LMELLNQ+DGFD    VK+IMATNR D LDPALLRPGRLDRKIE PLP+ + +  I ++  + +    E+D E  V   +  +GA+++++C EAGM AIR  R  ++ +DF K  +
Sbjct:  165 AVELPLTHHNLYKQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTSAAFIRVVGSEFVQKYLGEGPRLVRDVFRLARENSPAIIFIDEIDAIATKRFDAQTGADREVQRILMELLNQMDGFDVSVNVKVIMATNRQDTLDPALLRPGRLDRKIEFPLPDRRQKRLIFQVITSKMNLSDEVDLEDYVSRPDKLSGAEIQSICQEAGMHAIRKNRYVILPKDFEKGYK 389          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS6A_YEAST (26S protease regulatory subunit 6A OS=Saccharomyces cerevisiae GN=RPT5 PE=1 SV=3)

HSP 1 Score: 243.817 bits (621), Expect = 9.916e-64
Identity = 121/239 (50.63%), Postives = 171/239 (71.55%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHY 719
            +I LP+   + F  +GI+ PKG L+YGPPGTGKTLLARA A+  +A FLK+ +  ++  YIGE A+L+R+ F  A++  P IIF+DE+DAIG +RF    S DRE+QRT++ELLNQLDGF    +VK++ ATNR DVLDPALLR GRLDRKIE PLP+E SR +IL+IH+  +    +I+++ + +  + FNGA L+ V  EAGM A+R  +  V HEDF++ + ++ +A+K +S + Y
Sbjct:  196 AIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLAAPQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV-QARKSKSVSFY 433          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS6A_MOUSE (26S protease regulatory subunit 6A OS=Mus musculus GN=Psmc3 PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 9.916e-64
Identity = 117/232 (50.43%), Postives = 164/232 (70.69%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKK 698
            +I LP+ + E F  +GI+PPKGVL+YGPPGTGKTLLARA A+   A FLK+    ++  +IG+ A+L+R+ F  A++  P IIF+DE+DAIG +RF    + DRE+QRT++ELLNQLDGF    +VK+I ATNR D+LDPALLR GRLDRKIE P+PNE++R  I++IH+  +    +++YE + +  + FNGA  + VC EAGM A+R     + HED M+ + ++   KK
Sbjct:  204 AIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQSKAVCVEAGMIALRRGATELTHEDHMEGILEVQAKKK 435          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR2_HALSA (Proteasome-activating nucleotidase 2 OS=Halobacterium salinarium GN=pan2 PE=3 SV=2)

HSP 1 Score: 242.276 bits (617), Expect = 2.885e-63
Identity = 114/229 (49.78%), Postives = 164/229 (71.62%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNE 689
            ++ELP+ +P LF  VGI PP GVLL+GPPGTGKTL+A+A+AS  DA+F+K+  S ++ K+IGE A+L+R++F  ARDH+P ++F+DEIDAI  +R    TS D E+QRT+M+LL+++DGFD+ G +++I ATNR D+LD A+LRPGR DR IE+P PN   R +I +IH   +     +D+  +       +GAD++ +CTEAGM AIR +R  V  +DF  A  KL++
Sbjct:  164 TVELPMKDPGLFETVGINPPSGVLLHGPPGTGKTLMAKAVASQTDASFIKMAGSELVHKFIGEGAKLVRDLFQVARDHEPAVVFIDEIDAIASKRTDSKTSGDAEVQRTMMQLLSEMDGFDERGDIRIIAATNRFDMLDRAILRPGRFDRLIEVPHPNVGGREKIFRIHTRAMNVADSVDFGELAADTGDLSGADVKAICTEAGMFAIRDDRTEVRMQDFQSAREKLDQ 392          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS6B_CAEEL (Probable 26S protease regulatory subunit 6B OS=Caenorhabditis elegans GN=rpt-3 PE=2 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 3.768e-63
Identity = 115/227 (50.66%), Postives = 163/227 (71.81%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            ++ELPL + EL+ ++GI PP+GVL+YGPPG GKT+LA+A+A+N  A+F++VV S  + KY+GE  R++R++F  A+++ P IIF+DEIDAI  +RF   T ADRE+QR L+ELLNQ+DGFDQ   VK+IMATNR D LDPALLRPGRLDRKIE PLP+ + +  +     + +    ++D E  V   +  +GAD+ ++C EAGM A+R  R  V+ +D  KA + +
Sbjct:  176 AVELPLTHGELYQQIGIDPPRGVLMYGPPGCGKTMLAKAVAANTAASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPSIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQSTNVKVIMATNRQDTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTVCSRMNLSDDVDLEDWVARPDKISGADINSICQEAGMQAVRENRYVVLTKDLEKAYKNV 402          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS6A_SCHPO (26S protease regulatory subunit 6A OS=Schizosaccharomyces pombe GN=tbp1 PE=2 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 3.768e-63
Identity = 115/231 (49.78%), Postives = 166/231 (71.86%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAK 695
            +I LP+   + F ++G+KPPKG L++GPPGTGKTLLARA A+  +A FLK+ +  ++  +IG+ A+L+R+ F  A++  P IIF+DE+DAIG +RF    + DRE+QRT++ELLNQLDGF    +VK+I ATNR D LDPALLR GRLDRK+E PLPNE++R+ IL+IH+  +A   +I++E + +  + +NGA L++VC EAGM A+R     + HE FM  + ++   K
Sbjct:  200 AIVLPMQQADKFRKLGVKPPKGCLMFGPPGTGKTLLARACAAQSNATFLKLAAPQLVQMFIGDGAKLVRDAFALAKEKSPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSDDRVKVIAATNRVDTLDPALLRSGRLDRKLEFPLPNEEARVGILRIHSRKMAIDDDINWEELARSTDEYNGAMLKSVCVEAGMIALRQGDTKINHEHFMDGILEVQMRK 430          
The following BLAST results are available for this feature:
BLAST of DC900089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 389
Match NameE-valueIdentityDescription
PRS6A_RAT2.609e-6450.4326S protease regulatory subunit 6A OS=Rattus norve... [more]
PRS6A_HUMAN2.609e-6450.4326S protease regulatory subunit 6A OS=Homo sapiens... [more]
PR6AB_XENLA2.609e-6450.0026S protease regulatory subunit 6A-B OS=Xenopus la... [more]
PRS6B_MANSE4.451e-6451.0526S protease regulatory subunit 6B OS=Manduca sext... [more]
PRS6B_DICDI9.916e-6452.4426S protease regulatory subunit 6B homolog OS=Dict... [more]
PRS6A_YEAST9.916e-6450.6326S protease regulatory subunit 6A OS=Saccharomyce... [more]
PRS6A_MOUSE9.916e-6450.4326S protease regulatory subunit 6A OS=Mus musculus... [more]
PSMR2_HALSA2.885e-6349.78Proteasome-activating nucleotidase 2 OS=Halobacter... [more]
PRS6B_CAEEL3.768e-6350.66Probable 26S protease regulatory subunit 6B OS=Cae... [more]
PRS6A_SCHPO3.768e-6349.7826S protease regulatory subunit 6A OS=Schizosaccha... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900089 VSS Citrus sinensis cDNA clone VS27V05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900089 ID=DC900089|Name=DC900089|organism=Citrus sinensis|type=EST|length=899bp
AATCTATTGAGCTACCTTTGATGAATCCTGAGCTTTTCCTTAGAGTTGGA
ATTAAACCTCCCAAGGGCGTTCTTCTTTATGGGCCTCCTGGAACTGGCAA
GACATTATTAGCACGAGCAATTGCCAGTAACATAGATGCAAATTTTCTGA
AGGTTGTTTCAAGTGCCATTATTGATAAGTACATTGGGGAAAGTGCAAGG
TTGATAAGAGAGATGTTTGGATACGCACGCGATCATCAACCCTGCATCAT
TTTTATGGATGAAATTGATGCCATCGGTGGGCGCCGTTTTAGTGAAGGAA
CCAGTGCAGATCGTGAAATTCAAAGGACACTGATGGAGTTACTTAATCAG
CTTGATGGATTTGATCAGCTTGGGAAGGTTAAAATGATAATGGCCACTAA
CAGACCTGATGTCCTTGACCCTGCACTTCTTCGTCCAGGGCGACTGGATA
GGAAAATTGAGATTCCATTGCCAAATGAGCAGTCAAGAATGGAAATTCTT
AAAATTCATGCTGCTGGCATTGCTAAGCATGGCGAGATTGATTATGAGGC
TGTTGTGAAGCTTGCAGAGGGCTTTAATGGGGCTGATCTCCGAAATGTTT
GCACCGAGGCTGGAATGTCGGCAATCCGTGCTGAACGTGATTATGTCATC
CACGAAGATTTTATGAAGGCTGTCCGGAAACTGAATGAGGCAAAGAAACT
TGAATCAAGTGCTCACTACAATGCTGATTTTGGAAAAGAGTAAAAACATT
TAGGAAAAGAGCCAAGGATCTTGAGGCAGTGCGGTTATTTTTCAGATGTA
ATTGTTTTCATATTTTTGTTAAAACATCTTGCTTTAATTTGTGAAGTTAG
TGGTTCTTTGAGCGATGGAATGCTNTATATATTAAACAATCATTCACGT
back to top