DC900088

Overview
NameDC900088
Unique NameDC900088
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1103
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2287 contig Csv1_Contig2287:180..1282. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATC_BOVIN (Aspartate aminotransferase, cytoplasmic OS=Bos taurus GN=GOT1 PE=1 SV=3)

HSP 1 Score: 352.829 bits (904), Expect = 2.045e-96
Identity = 173/334 (51.80%), Postives = 233/334 (69.76%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYH-----QLTIYIPQPTWGNHPKVFTLAGLS-VKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAVTRM 984
            +F   +++L LG DSPA+++ RV  VQCL GTG+LR+GAEFLAR Y+        +Y+  PTW NH  VF  AG   +++Y Y+D A RGL+ QG L DL  AP  +I +LHACAHNPTG DPT EQW+QI  +M+ + L PFFDSAYQGFASGSL+ DA ++R FV++G E   AQS++KN GLY ERVG L++V K  D   RV SQ++ ++R  +S+PP  GA IVA  L D  ++ EWT  +K MADRI++MR +L   L A  TPG W+HI +QIGMF+FTGLN +QV ++  E HIY+   GRI+M GL++K + ++  +IH AVT++
Sbjct:   79 EFRTCASRLALGDDSPALQEKRVGGVQCLGGTGALRIGAEFLARWYNGTNNKDTPVYVSSPTWENHNGVFIAAGFKDIRSYHYWDAAKRGLDLQGFLNDLEKAPEFSIFVLHACAHNPTGTDPTPEQWKQIASVMKRRFLFPFFDSAYQGFASGSLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVAKEPDSILRVLSQMEKIVRITWSNPPAQGARIVARTLSDPELFNEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITEQIGMFSFTGLNPKQVEYLINEKHIYLLPSGRINMCGLTTKNLEYVATSIHEAVTKI 412          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATC_DICDI (Aspartate aminotransferase, cytoplasmic OS=Dictyostelium discoideum GN=aatB PE=3 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 7.770e-96
Identity = 173/327 (52.91%), Postives = 227/327 (69.42%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTI-YIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAVT 978
            +FNKLSAKL+ G D+   K+ R+ TVQ LSGTG+LR+G  F+ ++    T+ YI +P+W NH  +   +G+    Y YYDP T+GL+F G++ D+RAAP+G++ +LH CAHNPTGVDPT EQW  I  +MR K  +PF D AYQG+ASG LD DA S R+F+  G E   AQSY+KN GLYGER GAL+IV   EDV  ++ SQLK+ IR MYSSPP HGA +V T+L D  +   W  ELK M+ RI  +RQ++ DAL AR  PG+W HI+ QIGMFT+TGL   QV  +  +YHIY+   GR+S+AGL++K + +  DAI  AVT
Sbjct:  110 EFNKLSAKLLYG-DAMVGKEKRMVTVQALSGTGALRIGIIFIRKYLPAGTVVYISRPSWTNHHNICKESGVQSAEYAYYDPKTKGLDFTGMINDMRAAPNGSVFVLHLCAHNPTGVDPTHEQWNIIADVMREKNHIPFMDCAYQGYASGDLDYDAYSARLFLNRGFEMFSAQSYSKNFGLYGERTGALTIVSHREDVIPKMLSQLKMDIRAMYSSPPTHGARLVTTVLSDPELTALWVKELKEMSGRIKDVRQKVLDALIARKVPGNWEHIVNQIGMFTYTGLTKPQVDILVNKYHIYLLGSGRVSLAGLNNKNIDYFADAILDAVT 435          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATC_PIG (Aspartate aminotransferase, cytoplasmic OS=Sus scrofa GN=GOT1 PE=1 SV=3)

HSP 1 Score: 350.132 bits (897), Expect = 1.325e-95
Identity = 173/334 (51.80%), Postives = 232/334 (69.46%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYH-----QLTIYIPQPTWGNHPKVFTLAGLS-VKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAVTRM 984
            +F   +++L LG DSPA+++ RV  VQ L GTG+LR+GAEFLAR Y+        +Y+  PTW NH  VFT AG   +++YRY+D   RGL+ QG L DL  AP  +I +LHACAHNPTG DPT EQW+QI  +M+ + L PFFDSAYQGFASG+L+ DA ++R FV++G E   AQS++KN GLY ERVG L++V K  D   RV SQ++ ++R  +S+PP  GA IVA  L D  ++ EWT  +K MADRI+SMR +L   L A  TPG W+HI  QIGMF+FTGLN +QV ++  E HIY+   GRI+M GL++K + ++  +IH AVT++
Sbjct:   79 EFRTCASRLALGDDSPALQEKRVGGVQSLGGTGALRIGAEFLARWYNGTNNKDTPVYVSSPTWENHNGVFTTAGFKDIRSYRYWDTEKRGLDLQGFLSDLENAPEFSIFVLHACAHNPTGTDPTPEQWKQIASVMKRRFLFPFFDSAYQGFASGNLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVAKEPDSILRVLSQMEKIVRVTWSNPPAQGARIVARTLSDPELFHEWTGNVKTMADRILSMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLINEKHIYLLPSGRINMCGLTTKNLDYVATSIHEAVTKI 412          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATC_HORSE (Aspartate aminotransferase, cytoplasmic OS=Equus caballus GN=GOT1 PE=1 SV=2)

HSP 1 Score: 347.821 bits (891), Expect = 6.578e-95
Identity = 172/333 (51.65%), Postives = 232/333 (69.67%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYH-----QLTIYIPQPTWGNHPKVFTLAGLS-VKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAVTR 981
            +F   +++L LG DSPA+++ RV  VQ L GTG+LR+GAEFL+R Y+        +Y+  PTW NH  VF+ AG   +++Y Y+D   RGL+ QG L DL  AP  +I +LHACAHNPTG DPT EQW+QI  +M+ + L PFFDSAYQGFASG+LD DA +VR FV++G E   AQS++KN GLY ERVG L++V K  D   RV SQ++ ++R  +S+PP  GA IVA  L D  ++KEWT  +K MADRI+SMR +L   L A  TPG W+HI +QIGMF+FTGLN +QV ++  + HIY+   GRI+M GL++K + ++  +IH AVT+
Sbjct:   79 EFRSCASRLALGDDSPALQEKRVGGVQSLGGTGALRIGAEFLSRWYNGTNNKNTPVYVSSPTWENHNGVFSGAGFKDIRSYHYWDATKRGLDLQGFLNDLENAPEFSIFVLHACAHNPTGTDPTPEQWKQIASVMKRRFLFPFFDSAYQGFASGNLDRDAWAVRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVAKEPDSILRVLSQMQKIVRITWSNPPAQGARIVAFTLSDPGLFKEWTGNVKTMADRILSMRSELRARLEALKTPGTWNHITEQIGMFSFTGLNPKQVEYLVNQKHIYLLPSGRINMCGLTTKNLDYVATSIHEAVTK 411          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATC_PONAB (Aspartate aminotransferase, cytoplasmic OS=Pongo abelii GN=GOT1 PE=2 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 1.465e-94
Identity = 170/334 (50.90%), Postives = 237/334 (70.96%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYH-----QLTIYIPQPTWGNHPKVFTLAGLS-VKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAVTRM 984
            +F   +++L LG DSPA+K+ RV  VQ L GTG+LR+GA+FLAR Y+        +Y+  PTW NH  VF+ AG   +++YRY+D   RGL+ QGLL DL  AP  +IV+LHACAHNPTG DPT EQW+QI  +M+ + L PFFDSAYQGFASG+L+ DA ++R FV++G E   AQS++KN GLY ERVG L++V K  +   RV SQ++ ++R  +S+PP  GA IVA+ L +  +++EWT  +K MADRI++MR +L   L A  TPG W+HI  QIGMF+FTGLN +QV ++  E HIY+   GRI+++GL++K + ++  +IH AVT++
Sbjct:   79 EFRSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGLLNDLENAPEFSIVVLHACAHNPTGTDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPEGILRVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLINEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKI 412          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATC_PANTR (Aspartate aminotransferase, cytoplasmic OS=Pan troglodytes GN=GOT1 PE=2 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 1.465e-94
Identity = 169/334 (50.60%), Postives = 237/334 (70.96%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYH-----QLTIYIPQPTWGNHPKVFTLAGLS-VKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAVTRM 984
            +F   +++L LG DSPA+K+ RV  VQ L GTG+LR+GA+FLAR Y+        +Y+  PTW NH  VF+ AG   +++YRY+D   RGL+ QG L DL  AP  +IV+LHACAHNPTG+DPT EQW+QI  +M+ + L PFFDSAYQGFASG+L+ DA ++R FV++G E   AQS++KN GLY ERVG L++V K  +   +V SQ++ ++R  +S+PP  GA IVA+ L +  +++EWT  +K MADRI+SMR +L   L A  TPG W+HI  QIGMF+FTGLN +QV ++  E HIY+   GRI+++GL++K + ++  +IH AVT++
Sbjct:   79 EFRSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILSMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKI 412          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATC_MOUSE (Aspartate aminotransferase, cytoplasmic OS=Mus musculus GN=Got1 PE=1 SV=2)

HSP 1 Score: 345.895 bits (886), Expect = 2.500e-94
Identity = 171/334 (51.20%), Postives = 231/334 (69.16%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYH-----QLTIYIPQPTWGNHPKVFTLAGLS-VKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAVTRM 984
            +F   +++L+LG +SPAI++NRV  VQ L GTG+LR+GA+FL R Y+        IY+  PTW NH  VF+ AG   ++ Y Y+D   RGL+ QG L DL  AP  +I +LHACAHNPTG DPT EQW+QI  +M+ + L PFFDSAYQGFASG L+ DA ++R FV++G E   AQS++KN GLY ERVG L++V K  D   RV SQ++ ++R  +S+PP  GA IVA  L D  ++KEW   +K MADRI++MR +L   L A  TPG WSHI +QIGMF+FTGLN +QV ++  E HIY+   GRI+M GL++K + ++  +IH AVT++
Sbjct:   79 EFRSCASRLVLGDNSPAIRENRVGGVQSLGGTGALRIGADFLGRWYNGTDNKNTPIYVSSPTWENHNAVFSAAGFKDIRPYCYWDAEKRGLDLQGFLNDLENAPEFSIFVLHACAHNPTGTDPTPEQWKQIAAVMQRRFLFPFFDSAYQGFASGDLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVGKESDSVLRVLSQMEKIVRITWSNPPAQGARIVAATLSDPELFKEWKGNVKTMADRILTMRSELRARLEALKTPGTWSHITEQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINMCGLTTKNLDYVATSIHEAVTKI 412          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AAT1_ARATH (Aspartate aminotransferase, mitochondrial OS=Arabidopsis thaliana GN=ASP1 PE=1 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 2.500e-94
Identity = 170/318 (53.46%), Postives = 222/318 (69.81%), Query Frame = 1
Query:   13 LSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIH 966
            L+ KL  G +S  IKD R+  VQ LSGTG+ R+ A+F  R      IYIP PTW NH  ++  A +  KTY YY P T+GL+F  L++D++ AP G+  LLHACAHNPTGVDPT EQW +I QL ++K    FFD AYQGFASG    DA+S+R+F+ DG    ++QSYAKNMGLYG+RVG LS++C+    A  V+SQL+ + RPMYS+PP+HGA +V+TIL+D  +   W  E+K MADRII MR  L ++L   G+P  W H+ KQIGMF ++GL  EQV  +T EYHIYMT +GRISMAG+++  V +L +AIH
Sbjct:  107 LTLKLAYGDNSEFIKDKRIAAVQTLSGTGACRLFADFQKRFSPGSQIYIPVPTWSNHHNIWKDAQVPQKTYHYYHPETKGLDFSALMDDVKNAPEGSFFLLHACAHNPTGVDPTEEQWREISQLFKAKKHFAFFDMAYQGFASGDPARDAKSIRIFLEDGHHIGISQSYAKNMGLYGQRVGCLSVLCEDPKQAVAVKSQLQQLARPMYSNPPLHGAQLVSTILEDPELKSLWLKEVKVMADRIIGMRTTLRESLEKLGSPLSWEHVTKQIGMFCYSGLTPEQVDRLTSEYHIYMTRNGRISMAGVTTGNVGYLANAIH 424          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATC_HUMAN (Aspartate aminotransferase, cytoplasmic OS=Homo sapiens GN=GOT1 PE=1 SV=3)

HSP 1 Score: 345.51 bits (885), Expect = 3.265e-94
Identity = 168/334 (50.30%), Postives = 237/334 (70.96%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYH-----QLTIYIPQPTWGNHPKVFTLAGLS-VKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAVTRM 984
            +F   +++L LG DSPA+K+ RV  VQ L GTG+LR+GA+FLAR Y+        +Y+  PTW NH  VF+ AG   +++YRY+D   RGL+ QG L DL  AP  +IV+LHACAHNPTG+DPT EQW+QI  +M+ + L PFFDSAYQGFASG+L+ DA ++R FV++G E   AQS++KN GLY ERVG L++V K  +   +V SQ++ ++R  +S+PP  GA IVA+ L +  +++EWT  +K MADRI++MR +L   L A  TPG W+HI  QIGMF+FTGLN +QV ++  E HIY+   GRI+++GL++K + ++  +IH AVT++
Sbjct:   79 EFRSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKI 412          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATC_RAT (Aspartate aminotransferase, cytoplasmic OS=Rattus norvegicus GN=Got1 PE=1 SV=3)

HSP 1 Score: 343.969 bits (881), Expect = 9.498e-94
Identity = 168/333 (50.45%), Postives = 233/333 (69.97%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYH-----QLTIYIPQPTWGNHPKVFTLAGLS-VKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAVTR 981
            +F   +++L+LG +SPA+++NRV  VQ L GTG+LR+GA+FL R Y+        +Y+  PTW NH  VF+ AG   +++YRY+D   RGL+ QG L DL  AP  +I +LHACAHNPTG DPT E+W+QI  +M+ + L PFFDSAYQGFASG L+ DA ++R FV++G E   AQS++KN GLY ERVG L++V K  D   RV SQ++ ++R  +S+PP  GA IVAT L +  ++KEW   +K MADRI++MR +L   L A  TPG WSHI +QIGMF+FTGLN +QV ++  E HIY+   GRI+M GL++K + ++  +I+ AVT+
Sbjct:   79 EFRSCASQLVLGDNSPALRENRVGGVQSLGGTGALRIGADFLGRWYNGTDNKNTPVYVSSPTWENHNGVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIFVLHACAHNPTGTDPTEEEWKQIAAVMKRRFLFPFFDSAYQGFASGDLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVGKEHDSVLRVLSQMEKIVRITWSNPPAQGARIVATTLSNPELFKEWKGNVKTMADRILTMRSELRARLEALKTPGTWSHITEQIGMFSFTGLNPKQVEYLVNEKHIYLMPSGRINMCGLTTKNLDYVATSINEAVTK 411          
The following BLAST results are available for this feature:
BLAST of DC900088 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 50
Match NameE-valueIdentityDescription
AATC_BOVIN2.045e-9651.80Aspartate aminotransferase, cytoplasmic OS=Bos tau... [more]
AATC_DICDI7.770e-9652.91Aspartate aminotransferase, cytoplasmic OS=Dictyos... [more]
AATC_PIG1.325e-9551.80Aspartate aminotransferase, cytoplasmic OS=Sus scr... [more]
AATC_HORSE6.578e-9551.65Aspartate aminotransferase, cytoplasmic OS=Equus c... [more]
AATC_PONAB1.465e-9450.90Aspartate aminotransferase, cytoplasmic OS=Pongo a... [more]
AATC_PANTR1.465e-9450.60Aspartate aminotransferase, cytoplasmic OS=Pan tro... [more]
AATC_MOUSE2.500e-9451.20Aspartate aminotransferase, cytoplasmic OS=Mus mus... [more]
AAT1_ARATH2.500e-9453.46Aspartate aminotransferase, mitochondrial OS=Arabi... [more]
AATC_HUMAN3.265e-9450.30Aspartate aminotransferase, cytoplasmic OS=Homo sa... [more]
AATC_RAT9.498e-9450.45Aspartate aminotransferase, cytoplasmic OS=Rattus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900088 VSS Citrus sinensis cDNA clone VS27V02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900088 ID=DC900088|Name=DC900088|organism=Citrus sinensis|type=EST|length=1103bp
GATTTTAATAAATTGAGTGCAAAGCTCATCCTTGGTGCTGACAGCCCTGC
GATTAAAGACAACAGAGTGACCACCGTTCAGTGCTTGTCTGGCACTGGTT
CTTTGAGGGTTGGAGCTGAGTTTCTGGCAAGGCATTATCACCAACTTACC
ATATATATTCCACAGCCAACATGGGGAAACCATCCCAAAGTTTTCACTTT
AGCAGGATTGTCTGTGAAGACCTACCGCTATTATGATCCAGCAACACGTG
GGCTAAACTTCCAAGGCTTGCTGGAGGATCTTAGGGCTGCACCATCCGGA
GCTATAGTTCTTCTTCATGCATGTGCTCATAATCCAACTGGTGTTGACCC
GACCCTTGAGCAGTGGGAGCAGATCAGGCAGCTGATGAGGTCAAAAGGAT
TGTTACCTTTCTTTGACAGTGCTTATCAGGGTTTTGCAAGTGGTAGCCTA
GATGCAGATGCACAATCTGTTCGCATGTTTGTGGCAGATGGTGGCGAATG
CCTGGTAGCTCAGAGTTATGCGAAAAACATGGGACTCTATGGGGAACGTG
TCGGCGCCCTCAGCATTGTCTGCAAGACAGAAGATGTGGCAAGCAGGGTT
GAAAGCCAGTTGAAACTCGTGATTAGGCCCATGTACTCTAGTCCACCTAT
TCACGGGGCCTCTATTGTGGCTACAATTCTCAAGGACAGCACTATGTATA
AAGAGTGGACTCTTGAACTGAAAGCGATGGCTGACCGGATTATAAGCATG
CGTCAGCAACTATTTGATGCTCTGTCTGCTAGAGGCACTCCAGGAGACTG
GAGTCACATTATCAAGCAAATAGGAATGTTTACATTCACAGGGCTGAACA
GTGAACAAGTTGCCTTCATGACCAAGGAGTATCACATTTATATGACATCT
GATGGGAGGATTAGCATGGCAGGTCTTAGTTCAAAGACAGTTCCTCATCT
TACCGATGCTATACATGCTGCTGTAACCCGAATGGGCTAAGATTAATCAG
ACAAGAATTCATGCCGTAAGAATTGTTTGGTTTTCAGTCACCCTCAGCAA
TGCAAAAATGAGTTTGTAGAACTAGAAAATGCATAAATAAAGGTTTTACA
TTA
back to top