DC900088

Overview
NameDC900088
Unique NameDC900088
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1103
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2287 contig Csv1_Contig2287:180..1282. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: TYRB_ECOLI (Aromatic-amino-acid aminotransferase OS=Escherichia coli (strain K12) GN=tyrB PE=1 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 5.789e-75
Identity = 133/319 (41.69%), Postives = 205/319 (64.26%), Query Frame = 1
Query:   19 AKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAV 975
            A L+ GAD P +K  RV T+Q L G+G+L+VGA+FL R++ +  +++  PTW NH  +F  AG  V TY +YD AT G+ F  LL  L+  P+ +IVLLH C HNPTG D T +QW+ + ++++++ L+PF D AYQGF +G ++ DA ++R   + G   LV+ S++K   LYGERVG LS++C+  + A RV  QLK  +R  YSSPP  GA +VA +L D  +   W  E++ M  RI++MRQ+L   LS      ++ +++ Q GMF++TGL++ QV  + +E+ +Y+ + GR+ +AGL++  V  +  A  A +
Sbjct:   80 APLLFGADHPVLKQQRVATIQTLGGSGALKVGADFLKRYFPESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATLKTLPARSIVLLHPCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAG-MEEDAYAIRAIASAGLPALVSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLKATVRRNYSSPPNFGAQVVAAVLNDEALKASWLAEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQRGMFSYTGLSAAQVDRLREEFGVYLIASGRMCVAGLNTANVQRVAKAFAAVM 397          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: TYRB_KLEPN (Tyrosine aminotransferase OS=Klebsiella pneumoniae GN=tyrB PE=1 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 8.360e-74
Identity = 134/324 (41.36%), Postives = 206/324 (63.58%), Query Frame = 1
Query:    4 FNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAV 975
            + +  A L+ GA+  A+K NR+ ++Q + G+G+L+VGA+FL R++ +  +++  PTW NH  +F  AG  V TY ++D AT G+ F+ LL  L+  P+  IVLLH C HNPTG D T  QW+++ ++++++ L+PF D AYQGF  G L+ DA ++R   + G   LV+ S++K   LYGERVG LS+VC+  + A RV  QLK  +R  YSSPP  GA +VAT+L D+ +   W  E+ AM   I++MRQ L DAL          +++KQ GMF++TG ++ QV  +  E+ +Y+ + GR+ +AGL+S+ V  +  A  A +
Sbjct:   75 YRQAIAPLLFGAEHTALKQNRIASIQTVGGSGALKVGADFLKRYFPESHVWVSDPTWENHIAIFEGAGFEVSTYPWFDKATNGVRFENLLAMLQTLPARDIVLLHPCCHNPTGADLTPAQWDRVVEVLKARQLIPFLDIAYQGF-GGGLEEDAYAIRAIASAGMPMLVSNSFSKIFSLYGERVGGLSVVCEDSETAGRVLGQLKATVRRNYSSPPSFGAQVVATVLNDAALKATWQAEVDAMRAHILTMRQALVDALQQVAPGSKVDYLLKQRGMFSYTGFSAAQVDRLRDEFGVYLIASGRMRVAGLNSRNVQQVAKAFVAVM 397          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATC_YEAST (Aspartate aminotransferase, cytoplasmic OS=Saccharomyces cerevisiae GN=AAT2 PE=1 SV=3)

HSP 1 Score: 273.863 bits (699), Expect = 1.207e-72
Identity = 139/327 (42.51%), Postives = 202/327 (61.77%), Query Frame = 1
Query:   16 SAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFV---ADGGECLVAQSYAKNMGLYGERVG----ALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAV 975
            +AK+I G  S A +++RV +VQ LSGTG+L + A+F ++ +    +Y+ +PTW NH  +F   GL   TY Y+   T+ L+  G L  ++ AP G+I +LH+CAHNPTG+DPT EQW QI   + SK  +  FD+AYQGFA+G LD DA +VR+ V   +      V QS+AKN G+YGERVG    AL+   + + +   V SQL  +IR   S+PP +GA IVA +L+   + ++W  ++  M+ RI  MR  L D L   GTPG+W HI+ Q GMF+FTGL  + V  + + + +Y+ + GR S+AGL+   V ++  AI   V
Sbjct:   83 AAKIIFGTQSDAFQEDRVISVQSLSGTGALHISAKFFSKFFPDKLVYLSKPTWANHMAIFENQGLKTATYPYWANETKSLDLNGFLNAIQKAPEGSIFVLHSCAHNPTGLDPTSEQWVQIVDAIASKNHIALFDTAYQGFATGDLDKDAYAVRLGVEKLSTVSPVFVCQSFAKNAGMYGERVGCFHLALTKQAQNKTIKPAVTSQLAKIIRSEVSNPPAYGAKIVAKLLETPELTEQWHKDMVTMSSRITKMRHALRDHLVKLGTPGNWDHIVNQCGMFSFTGLTPQMVKRLEETHAVYLVASGRASIAGLNQGNVEYVAKAIDEVV 409          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: PHHC_PSEAE (Aromatic-amino-acid aminotransferase OS=Pseudomonas aeruginosa GN=phhC PE=3 SV=2)

HSP 1 Score: 238.039 bits (606), Expect = 7.340e-62
Identity = 127/315 (40.32%), Postives = 186/315 (59.05%), Query Frame = 1
Query:   19 AKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAI 963
            A+L LGA SP + + R    Q   GTG+LR+  +F+A       I++  PTW  H  +F  AGL V  Y Y     R L+ + +L  L   P G +VLLHAC HNPTG D + + W ++  ++R + LLP  D AYQGF  G L+ DA +VR+F  +  E LV  S +KN GLY +RVGAL +  +  +  + + SQL  + R ++S+PP HGA +VA IL DS +   W  E++ M  RI S+R  L +AL+  G    ++H+  Q GMF++TGL+ +QVA +  E+ +Y+ S GR ++AGL ++ +  L  AI
Sbjct:   81 AELALGAASPLLLEQRADATQTPGGTGALRLAGDFIAHCLPGRGIWLSDPTWPIHETLFAAAGLKVSHYPYVSADNR-LDVEAMLAGLERIPQGDVVLLHACCHNPTGFDLSHDDWRRVLDVVRRRELLPLIDFAYQGFGDG-LEEDAWAVRLFAGELPEVLVTSSCSKNFGLYRDRVGALIVCAQNAEKLTDLRSQLAFLARNLWSTPPAHGAEVVAAILGDSELKGLWQEEVEGMRSRIASLRIGLVEALAPHGLAERFAHVGAQRGMFSYTGLSPQQVARLRDEHAVYLVSSGRANVAGLDARRLDRLAQAI 393          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: TYRB_PARDE (Aromatic-amino-acid aminotransferase OS=Paracoccus denitrificans GN=tyrB PE=1 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 1.384e-60
Identity = 122/321 (38.01%), Postives = 175/321 (54.52%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAI 963
            +F K   +LILG     +K     T+  + GTG+LR   E        L +++  PTW NH  +    GL V+TYRY+D  TRG++F+G+  DL AA  G +VLLH C HNPTG + TL+QW +I  ++   G LP  D AYQGF  G L+ DA   R+  +   E L+A S +KN G+Y ER G L  +C         +  +  + R  YS PP HGA IV+T+L    +  +W  EL+A+   ++ +R+QL   L        +  + +  GMF+  G   EQV  + +E+ IYM  D RI++AGL+  T+P L  AI
Sbjct:   73 EFQKAMGELILG---DGLKSETTATLATVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADLAAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDG-LEEDAAGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGMFSRLGATPEQVKRIKEEFGIYMVGDSRINIAGLNDNTIPILARAI 389          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATM_YEAST (Aspartate aminotransferase, mitochondrial OS=Saccharomyces cerevisiae GN=AAT1 PE=1 SV=2)

HSP 1 Score: 206.453 bits (524), Expect = 2.367e-52
Identity = 118/332 (35.54%), Postives = 186/332 (56.02%), Query Frame = 1
Query:   61 NRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGL-SVKTYRYYDPATRGLNFQGLLEDLRAAP---------SGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRM------FVADGGECLVAQSYAKNMGLYGERVGALSIVC-------------KTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHA 969
            +R++ VQ LSGTG+L V A+FLA    +  I+IP P+W NH  +F   G  ++  Y YY      ++  G +E L+            +   ++LHAC HNPTG+DPT EQWE+I   +    ++P  D AYQG  SG+L  DA  +R+      +        + QS+AKNMGLYGERVG+LS++              +   +   ++SQLK ++R MYSSPP +G+ +V  +L D  + ++W  ++  M  R+  +RQ++FD L   G P D  +  +Q GMF +T  + +QV  +   Y +Y+T DGR+S++G++   V +L +++ A
Sbjct:  119 DRISFVQTLSGTGALAVAAKFLALFISR-DIWIPDPSWANHKNIFQNNGFENIYRYSYYKDGQ--IDIDGWIEQLKTFAYNNQQENNKNPPCIILHACCHNPTGLDPTKEQWEKIIDTIYELKMVPIVDMAYQGLESGNLLKDAYLLRLCLNVNKYPNWSNGIFLCQSFAKNMGLYGERVGSLSVITPATANNGKFNPLQQKNSLQQNIDSQLKKIVRGMYSSPPGYGSRVVNVVLSDFKLKQQWFKDVDFMVQRLHHVRQEMFDRL---GWP-DLVNFAQQHGMFYYTRFSPKQVEILRNNYFVYLTGDGRLSLSGVNDSNVDYLCESLEA 443          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: ATTY_RHIME (Tyrosine aminotransferase OS=Rhizobium meliloti GN=tatA PE=3 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 5.456e-49
Identity = 117/302 (38.74%), Postives = 170/302 (56.29%), Query Frame = 1
Query:   28 ILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSS 933
            ++G D+  I+ + V  VQ   G+G+LR+ A+ +AR   +  I++  P+W NH  +F  AGL + TY ++D  ++ + F  L+  L  A SG  VLLHA  HNPTG   +  QW +I  L+  +GLLP  D AYQGF  G LD D   +R  +    E LVA S +K+ GLY ER GA+     +   A RV S L  + R  YS PP HGA++V TIL D  + ++WT EL+ M  R+  +R+ L + L  R        +  Q GMF+   L+  +V  +  E+ IYM + GRI++AGL +
Sbjct:   81 LVGGDT--IERSHVAGVQTPGGSGALRLAADLIARMGGR-GIWLGLPSWPNHAPIFKAAGLDIATYDFFDIPSQSVIFDNLVSALEGAASGDAVLLHASCHNPTGGVLSEAQWMEIAALVAERGLLPLVDLAYQGFGRG-LDQDVAGLRHLLGVVPEALVAVSCSKSFGLYRERAGAIFARTSSTASADRVRSNLAGLARTSYSMPPDHGAAVVRTILDDPELRRDWTEELETMRLRMTGLRRSLAEGLRTRWQ--SLGAVADQEGMFSMLPLSEAEVMRLRTEHGIYMPASGRINIAGLKT 376          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATC2_BOVIN (Putative aspartate aminotransferase, cytoplasmic 2 OS=Bos taurus GN=GOT1L1 PE=2 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 1.216e-48
Identity = 108/325 (33.23%), Postives = 179/325 (55.08%), Query Frame = 1
Query:    4 FNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTI-YIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAV 975
            F + S  L+ G +S  I +NR   VQ +  +G+ ++GA+FL        I YI       H  +F   G +V  + ++D A   L+   LL+ ++ AP G + ++ +  +       T  QW Q+  LM+SK + PFFD  YQG ++G L+ DA+ +  FV+ G E   +QS +KN G+Y E VG L +V     +  RV SQL    R ++ +PP  GA I+ ++L +  M  EW   L+ + + ++  ++++ + L   GTPG W HI +Q G  ++ GLNS+QV ++  E HIY+  +GRI+   ++S  + ++T +I+ AV
Sbjct:   79 FVQASLNLLFGKNSQVIVENRAGGVQTVGDSGAFQLGAQFLKSWCQSSQIVYIVSSQKEPHGLIFQDMGFTVYEHTFWDSAHLCLDPNMLLDVVKHAPHGCVFVIGSMGN----CQLTPSQWTQLMTLMKSKEIFPFFDIPYQGLSTGDLEEDARFLHYFVSQGFEFFCSQSLSKNFGIYDEGVGTLVVVTLDNQLLLRVLSQLMNFARALWLNPPTTGARIITSVLCNPAMQGEWRQSLEGVVENVMMTKEKVKEKLRLLGTPGSWDHITEQKGSHSYLGLNSQQVEYLISEKHIYIPKNGRINFTCINSYNIDYITSSINEAV 399          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATC2_HUMAN (Putative aspartate aminotransferase, cytoplasmic 2 OS=Homo sapiens GN=GOT1L1 PE=2 SV=2)

HSP 1 Score: 174.096 bits (440), Expect = 1.302e-42
Identity = 100/328 (30.49%), Postives = 175/328 (53.35%), Query Frame = 1
Query:    4 FNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFL-ARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHA---CAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAV 975
            F + S  L+ G  S AI +NRV  V  +  +G+ ++G +FL A H     +YI       H  VF   G +V  Y  +DP    ++   LL  +   P G ++++     C   P+G       W ++  +++SK + PFFD   QG  +  L+ D + ++ FV+ G E   +QS +KN G+Y E VG L +V         V SQL+ + + ++ +PP  GA ++ +IL +  +  EW   LK + + I+  ++++ + L   GTPG W HI +Q G   + GLNS+QV ++ ++ HIY+  +G+I+ + +++  + ++T+ I+ AV
Sbjct:   79 FIQASLALLFGKHSQAIVENRVGGVHTVGDSGAFQLGVQFLRAWHKDARIVYIISSQKELHGLVFQDMGFTVYEYSVWDPKKLCMDPDILLNVVEQIPHGCVLVMGNIIDCKLTPSG-------WAKLMSMIKSKQIFPFFDIPCQGLYTSDLEEDTRILQYFVSQGFEFFCSQSLSKNFGIYDEGVGMLVVVAVNNQQLLCVLSQLEGLAQALWLNPPNTGARVITSILCNPALLGEWKQSLKEVVENIMLTKEKVKEKLQLLGTPGSWGHITEQSGTHGYLGLNSQQVEYLVRKKHIYIPKNGQINFSCINANNINYITEGINEAV 399          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATC2_MOUSE (Putative aspartate aminotransferase, cytoplasmic 2 OS=Mus musculus GN=Got1l1 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.031e-39
Identity = 97/325 (29.85%), Postives = 172/325 (52.92%), Query Frame = 1
Query:    4 FNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIY-IPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAV 975
            F + S +L+ G  S AI + RV  V  +  +G+ ++GA+FL      + I  I          +F   G  V  Y  ++ +    +    +E L+  P G+I+++     N T    T  QW ++  +++SK + PFFD   QG ++G L+ D + ++ FV+ G E   +QS +KN G+Y E VG L +   +      V SQL   ++ ++ +PP  GA I+ +IL +  ++ EW   LK + + ++ +++++ + L   GTPG W HI +Q G   + GL  +QV F+ K+ HIY+    RI+   ++++ + ++T +IH AV
Sbjct:   79 FIQSSLELLFGKHSEAIAEKRVGGVHIVGESGAFQLGAQFLKTWRKNVKIVCIVSCQKEQCGLIFQDMGFIVYEYSIWNASDLCSDPSMFVEVLQHIPVGSILVIG----NITDCKFTQNQWTKLMSIIKSKQIFPFFDIPCQGLSTGDLEEDTKILQYFVSLGLEFFCSQSLSKNFGIYDEGVGILVVAALSNQHLLCVLSQLMDYVQALWGNPPATGARIITSILCNPALFGEWKQSLKGVVENMMLIKEKVKEKLRLLGTPGSWDHITRQSGTHGYLGLTYQQVEFLVKKKHIYLPKTSRINFTCINARNIDYITQSIHEAV 399          
The following BLAST results are available for this feature:
BLAST of DC900088 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 50
Match NameE-valueIdentityDescription
TYRB_ECOLI5.789e-7541.69Aromatic-amino-acid aminotransferase OS=Escherichi... [more]
TYRB_KLEPN8.360e-7441.36Tyrosine aminotransferase OS=Klebsiella pneumoniae... [more]
AATC_YEAST1.207e-7242.51Aspartate aminotransferase, cytoplasmic OS=Sacchar... [more]
PHHC_PSEAE7.340e-6240.32Aromatic-amino-acid aminotransferase OS=Pseudomona... [more]
TYRB_PARDE1.384e-6038.01Aromatic-amino-acid aminotransferase OS=Paracoccus... [more]
AATM_YEAST2.367e-5235.54Aspartate aminotransferase, mitochondrial OS=Sacch... [more]
ATTY_RHIME5.456e-4938.74Tyrosine aminotransferase OS=Rhizobium meliloti GN... [more]
AATC2_BOVIN1.216e-4833.23Putative aspartate aminotransferase, cytoplasmic 2... [more]
AATC2_HUMAN1.302e-4230.49Putative aspartate aminotransferase, cytoplasmic 2... [more]
AATC2_MOUSE1.031e-3929.85Putative aspartate aminotransferase, cytoplasmic 2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900088 VSS Citrus sinensis cDNA clone VS27V02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900088 ID=DC900088|Name=DC900088|organism=Citrus sinensis|type=EST|length=1103bp
GATTTTAATAAATTGAGTGCAAAGCTCATCCTTGGTGCTGACAGCCCTGC
GATTAAAGACAACAGAGTGACCACCGTTCAGTGCTTGTCTGGCACTGGTT
CTTTGAGGGTTGGAGCTGAGTTTCTGGCAAGGCATTATCACCAACTTACC
ATATATATTCCACAGCCAACATGGGGAAACCATCCCAAAGTTTTCACTTT
AGCAGGATTGTCTGTGAAGACCTACCGCTATTATGATCCAGCAACACGTG
GGCTAAACTTCCAAGGCTTGCTGGAGGATCTTAGGGCTGCACCATCCGGA
GCTATAGTTCTTCTTCATGCATGTGCTCATAATCCAACTGGTGTTGACCC
GACCCTTGAGCAGTGGGAGCAGATCAGGCAGCTGATGAGGTCAAAAGGAT
TGTTACCTTTCTTTGACAGTGCTTATCAGGGTTTTGCAAGTGGTAGCCTA
GATGCAGATGCACAATCTGTTCGCATGTTTGTGGCAGATGGTGGCGAATG
CCTGGTAGCTCAGAGTTATGCGAAAAACATGGGACTCTATGGGGAACGTG
TCGGCGCCCTCAGCATTGTCTGCAAGACAGAAGATGTGGCAAGCAGGGTT
GAAAGCCAGTTGAAACTCGTGATTAGGCCCATGTACTCTAGTCCACCTAT
TCACGGGGCCTCTATTGTGGCTACAATTCTCAAGGACAGCACTATGTATA
AAGAGTGGACTCTTGAACTGAAAGCGATGGCTGACCGGATTATAAGCATG
CGTCAGCAACTATTTGATGCTCTGTCTGCTAGAGGCACTCCAGGAGACTG
GAGTCACATTATCAAGCAAATAGGAATGTTTACATTCACAGGGCTGAACA
GTGAACAAGTTGCCTTCATGACCAAGGAGTATCACATTTATATGACATCT
GATGGGAGGATTAGCATGGCAGGTCTTAGTTCAAAGACAGTTCCTCATCT
TACCGATGCTATACATGCTGCTGTAACCCGAATGGGCTAAGATTAATCAG
ACAAGAATTCATGCCGTAAGAATTGTTTGGTTTTCAGTCACCCTCAGCAA
TGCAAAAATGAGTTTGTAGAACTAGAAAATGCATAAATAAAGGTTTTACA
TTA
back to top