DC900083

Overview
NameDC900083
Unique NameDC900083
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length904
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6157 contig Csv1_Contig6157:99..990. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15_MEGAM (60S ribosomal protein L15 OS=Megalobrama amblycephala GN=rpl15 PE=2 SV=3)

HSP 1 Score: 229.95 bits (585), Expect = 1.498e-59
Identity = 118/186 (63.44%), Postives = 130/186 (69.89%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGH-LHHKARPSRRATWKRNNT 570
            KKQS+VMRFL RVRCW+YRQ  S+ R  RPTRPDKARRLGYKAKQ                   KG  YGKP + GV Q+KF RS +SVAEERAGR  GGLRVLNSYW+ EDSTYK+FEVIL+D  H AIR +P   W+   VHKHRE+RGLTSAGKK RGL GKGH  H     SRRA WKR NT
Sbjct:   13 KKQSNVMRFLLRVRCWQYRQLSSLHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGKPVHHGVNQIKFARSLQSVAEERAGRHCGGLRVLNSYWVGEDSTYKFFEVILIDTFHKAIRRNPDTQWITKAVHKHREMRGLTSAGKKSRGL-GKGHKFHLTIGGSRRAAWKRRNT 197          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15_ICTPU (60S ribosomal protein L15 OS=Ictalurus punctatus GN=rpl15 PE=2 SV=3)

HSP 1 Score: 229.95 bits (585), Expect = 1.498e-59
Identity = 118/186 (63.44%), Postives = 130/186 (69.89%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGH-LHHKARPSRRATWKRNNT 570
            KKQSDVMRFL RVRCW+YRQ  ++ R  RPTRPDKARRLGYKAKQ                   KG  YGKP + GV QLKF RS +SVAEERAGR  GGLRVLNSYW+ EDSTYK+FEVIL+D  H AIR +P   W+   VHKHRE+RGLTSAGKK RGL GKGH  H     SRRA W+R NT
Sbjct:   13 KKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGGLRVLNSYWVGEDSTYKFFEVILIDTFHKAIRRNPDTQWITKAVHKHREMRGLTSAGKKSRGL-GKGHKFHLTIGGSRRAPWRRRNT 197          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15_HYPNO (60S ribosomal protein L15 OS=Hypophthalmichthys nobilis GN=rpl15 PE=2 SV=3)

HSP 1 Score: 229.95 bits (585), Expect = 1.498e-59
Identity = 118/186 (63.44%), Postives = 130/186 (69.89%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGH-LHHKARPSRRATWKRNNT 570
            KKQS+VMRFL RVRCW+YRQ  S+ R  RPTRPDKARRLGYKAKQ                   KG  YGKP + GV Q+KF RS +SVAEERAGR  GGLRVLNSYW+ EDSTYK+FEVIL+D  H AIR +P   W+   VHKHRE+RGLTSAGKK RGL GKGH  H     SRRA WKR NT
Sbjct:   13 KKQSNVMRFLLRVRCWQYRQLSSLHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGKPVHHGVNQIKFARSLQSVAEERAGRHCGGLRVLNSYWVGEDSTYKFFEVILIDTFHKAIRRNPDTQWITKAVHKHREMRGLTSAGKKSRGL-GKGHKFHLTIGGSRRAAWKRRNT 197          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15_ANGJA (60S ribosomal protein L15 OS=Anguilla japonica GN=rpl15 PE=2 SV=3)

HSP 1 Score: 229.95 bits (585), Expect = 1.498e-59
Identity = 116/186 (62.37%), Postives = 128/186 (68.82%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGH-LHHKARPSRRATWKRNNT 570
            KKQSDVMRFL RVRCW+YRQ   + R  RPTRPDKARRLGYKAKQ                   KG  YGKP + GV Q+KF RS +S AEERAGR  G LRVLNSYW+ EDSTYK+FEVIL+DP H A+R DP   W+   VHKHRE+RGLTSAGKK RGL GKGH  H     SRRA W+R NT
Sbjct:   13 KKQSDVMRFLLRVRCWQYRQLSGLHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGKPVHHGVNQIKFARSLQSTAEERAGRHCGALRVLNSYWVGEDSTYKFFEVILIDPFHKAVRRDPDAQWITKAVHKHREMRGLTSAGKKSRGL-GKGHKFHLTIGGSRRAAWRRRNT 197          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15_SINKN (60S ribosomal protein L15 OS=Siniperca kneri GN=rpl15 PE=2 SV=3)

HSP 1 Score: 229.565 bits (584), Expect = 1.956e-59
Identity = 116/186 (62.37%), Postives = 129/186 (69.35%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGH-LHHKARPSRRATWKRNNT 570
            KKQSDVMRFL RVRCW+YRQ  ++ R  RPTRPDKARRLGYKAKQ                   KG  YGKP + GV Q+KF RS +S AEERAGR  G LRVLNSYW+ EDSTYK+FEVIL+DP H A+R +P   W+   VHKHRE+RGLTSAGKK RGL GKGH  H     SRRA WKR NT
Sbjct:   13 KKQSDVMRFLLRVRCWQYRQLSNLHRAPRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKGATYGKPVHHGVNQIKFARSLQSTAEERAGRHCGALRVLNSYWVGEDSTYKFFEVILIDPFHKAVRRNPDTQWITKAVHKHREMRGLTSAGKKSRGL-GKGHKFHLTIGGSRRAAWKRRNT 197          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15_HYDAT (60S ribosomal protein L15 OS=Hydra attenuata GN=RPL15 PE=2 SV=2)

HSP 1 Score: 228.794 bits (582), Expect = 3.337e-59
Identity = 117/186 (62.90%), Postives = 130/186 (69.89%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGH-LHHKARPSRRATWKRNNT 570
            KKQSDVMRFL RVRCW+YRQ  ++ R  RPTRPDKARRLGYKAKQ                   KG  YGKP + GV Q+KF RS +SVAEERAGR  GGLRVL+SYW+ EDSTYK+FEV+LVD  H AIR +P   W+   VHKHRE+RGLTSAGKK RGL GKGH  H     SRRA WKR NT
Sbjct:   13 KKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGKPVHHGVNQIKFARSLQSVAEERAGRHCGGLRVLSSYWVGEDSTYKFFEVVLVDTFHKAIRRNPDTQWITKAVHKHREMRGLTSAGKKSRGL-GKGHKFHLTIGGSRRAAWKRRNT 197          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15_CARAU (60S ribosomal protein L15 OS=Carassius auratus GN=rpl15 PE=2 SV=3)

HSP 1 Score: 228.794 bits (582), Expect = 3.337e-59
Identity = 117/186 (62.90%), Postives = 130/186 (69.89%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGH-LHHKARPSRRATWKRNNT 570
            KKQSDVMRFL RVRCW+YRQ  ++ R  RPTRPDKARRLGYKAKQ                   KG  YGKP + GV Q+KF RS +SVAEERAGR  GGLRVL+SYW+ EDSTYK+FEV+LVD  H AIR +P   W+   VHKHRE+RGLTSAGKK RGL GKGH  H     SRRA WKR NT
Sbjct:   13 KKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGKPVHHGVNQIKFARSLQSVAEERAGRHCGGLRVLSSYWVGEDSTYKFFEVVLVDTFHKAIRRNPDTQWITKAVHKHREMRGLTSAGKKSRGL-GKGHKFHLTIGGSRRAAWKRRNT 197          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15_SILAS (60S ribosomal protein L15 OS=Silurus asotus GN=rpl15 PE=2 SV=2)

HSP 1 Score: 227.639 bits (579), Expect = 7.434e-59
Identity = 116/186 (62.37%), Postives = 130/186 (69.89%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGH-LHHKARPSRRATWKRNNT 570
            KKQSDVMRFL RVRCW+YRQ  ++ R  R TRPDKARRLGYKAKQ                   KG  YGKP + GV QLKF RS +S+AEERAGR  GGLRVLNSYW+ EDSTYK+FEVIL+D  H AIR +P + W+   VHKHRE+RGLTSAGKK RGL GKGH  H     SRRA W+R NT
Sbjct:   13 KKQSDVMRFLLRVRCWQYRQLSALHRAPRATRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSIAEERAGRHCGGLRVLNSYWVGEDSTYKFFEVILIDTFHKAIRRNPDMQWITKAVHKHREMRGLTSAGKKSRGL-GKGHKFHLTIGGSRRAAWRRRNT 197          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15_PELFU (60S ribosomal protein L15 OS=Pelteobagrus fulvidraco GN=rpl15 PE=2 SV=3)

HSP 1 Score: 227.254 bits (578), Expect = 9.709e-59
Identity = 117/186 (62.90%), Postives = 130/186 (69.89%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGH-LHHKARPSRRATWKRNNT 570
            KKQSDVMRFL RVRCW+YRQ  ++ R  RPTRPDKARRLGYKAKQ                   KG  YGKP + GV Q+KF RS +SVAEERAGR  GGLRVL+SYW+ EDSTYK+FEVILVD  H AIR +P   W+   VHKHRE+RGLTSAGKK RGL GKGH  H     SRRA W+R NT
Sbjct:   13 KKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKGATYGKPVHHGVNQIKFARSLQSVAEERAGRHCGGLRVLSSYWVGEDSTYKFFEVILVDIFHKAIRRNPDTQWITKAVHKHREMRGLTSAGKKSRGL-GKGHKFHLTIGGSRRAAWRRRNT 197          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15_EPICO (60S ribosomal protein L15 OS=Epinephelus coioides GN=rpl15 PE=2 SV=2)

HSP 1 Score: 227.254 bits (578), Expect = 9.709e-59
Identity = 117/186 (62.90%), Postives = 128/186 (68.82%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGH-LHHKARPSRRATWKRNNT 570
            KKQSDVMRFL RVRCW+YRQ  ++ R  RPTRPDKARRLGYKAKQ                   KG  YGKP + GV Q+KF RS +S AEERAGR  G LRVLNSYW+ EDSTYK+FEVILVD  H AIR +P   W+   VHKHRE+RGLTSAGKK RGL GKGH  H     SRRA WKR NT
Sbjct:   13 KKQSDVMRFLLRVRCWQYRQLSNLHRAPRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKGATYGKPVHHGVNQIKFARSLQSTAEERAGRHCGALRVLNSYWVGEDSTYKFFEVILVDTFHKAIRRNPDTQWITKAVHKHREMRGLTSAGKKSRGL-GKGHKFHLTIGGSRRAAWKRRNT 197          
The following BLAST results are available for this feature:
BLAST of DC900083 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 92
Match NameE-valueIdentityDescription
RL15_MEGAM1.498e-5963.4460S ribosomal protein L15 OS=Megalobrama amblyceph... [more]
RL15_ICTPU1.498e-5963.4460S ribosomal protein L15 OS=Ictalurus punctatus G... [more]
RL15_HYPNO1.498e-5963.4460S ribosomal protein L15 OS=Hypophthalmichthys no... [more]
RL15_ANGJA1.498e-5962.3760S ribosomal protein L15 OS=Anguilla japonica GN=... [more]
RL15_SINKN1.956e-5962.3760S ribosomal protein L15 OS=Siniperca kneri GN=rp... [more]
RL15_HYDAT3.337e-5962.9060S ribosomal protein L15 OS=Hydra attenuata GN=RP... [more]
RL15_CARAU3.337e-5962.9060S ribosomal protein L15 OS=Carassius auratus GN=... [more]
RL15_SILAS7.434e-5962.3760S ribosomal protein L15 OS=Silurus asotus GN=rpl... [more]
RL15_PELFU9.709e-5962.9060S ribosomal protein L15 OS=Pelteobagrus fulvidra... [more]
RL15_EPICO9.709e-5962.9060S ribosomal protein L15 OS=Epinephelus coioides ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900083 VSS Citrus sinensis cDNA clone VS27Q90 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900083 ID=DC900083|Name=DC900083|organism=Citrus sinensis|type=EST|length=904bp
AATTCNGCACGAGGGAAGAAGCAGTCAGATGTGATGAGGTTCTTGCAGAG
GGTGAGGTGTTGGGAGTACCGCCAACATCCATCTATTGTTAGGGTCACCC
GTCCCACTCGACCTGACAAGGCTCGACGCTTGGGTTACAAGGCCAAGCAG
GGTTATGTTGTTTATCGTGTGCGGGTAAGGCGCGGTGGTCGGAACAGGCC
TGTTCCCAAGGGCATTGTGTATGGTAAACCCACAAACCAGGGTGTTACTC
AACTGAAGTTTCAGCGCAGCAAGAGGTCTGTTGCAGAGGAGCGTGCCGGT
CGTAAGTTGGGAGGTCTTAGGGTTCTCAATTCTTACTGGATCAATGAGGA
CTCCACTTATAAGTACTTTGAGGTGATCTTGGTTGATCCTGCTCATAATG
CCATCCGTAATGACCCAAGAATTAATTGGTTATGCAATCCTGTCCATAAG
CACAGGGAACTCCGTGGTCTTACTTCTGCAGGTAAGAAGTACAGAGGCCT
ACGTGGAAAAGGACACTTGCACCACAAGGCTCGGCCTTCGCGCAGGGCTA
CCTGGAAGAGAAACAATACTCTTTCCCTCCGTCGCTACCGTTGATCATTG
TTACGGTTTTGATGTTTATCATCAGTTGAGGGATTTTGTCTGGAGGACAT
AGTAGTTGCCATTTTGAGTCTTTTAGAGATTGAAATACTATGGAACATAT
CTTATTTTGAAACCGTACATTCTAAATTAAGACATTTGTGTTTCTTGAGT
CTACCTTGAATTATAAGAGCCTTAAATGTCTCATTCTGTTTAAGGTCTTG
TTGAGTATTTGTTTCGTCACTGCTGTGATTTATCACCTCTTGAACTAGCA
GATTTTAAGTTTTGGCTCAATTTTCAATTATGAGCTTGGCTTCGAGCACA
ACCA
back to top