DC900083

Overview
NameDC900083
Unique NameDC900083
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length904
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6157 contig Csv1_Contig6157:99..990. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_HALMA (50S ribosomal protein L15e OS=Haloarcula marismortui GN=rpl15e PE=1 SV=3)

HSP 1 Score: 124.405 bits (311), Expect = 8.863e-28
Identity = 73/169 (43.20%), Postives = 93/169 (55.03%), Query Frame = 1
Query:   43 LQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRA 549
            LQ  R  E+R   ++ R+ RPTR DKAR  GYKAKQ                   K     K   QGVT++  ++  + VAEERA R    LRVLNSY + +D   K+ EVIL+DP H AI+ND  ++W+C      R  RGLT AG++ RGL GKG    K RPS R+
Sbjct:   24 LQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSK--RQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRS 190          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_THEAC (50S ribosomal protein L15e OS=Thermoplasma acidophilum GN=rpl15e PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 2.579e-27
Identity = 73/177 (41.24%), Postives = 99/177 (55.93%), Query Frame = 1
Query:   19 KQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRA 549
            K+S++   +++ R  E+R  PSIVR+  PTR D+AR LG+K+K                     G    +P      +L  ++S + +AEERA  K   + VLNSY++ ED  YKYFEVILVD +H  I NDP I+W+  P +  R  RGLTSAG K RGLR       K+RPS R+
Sbjct:   18 KKSEIYDLVKK-RMIEWRHGPSIVRLEHPTRIDRARALGFKSKDGFIVVRSRVRRGGSNREKIMG--GRRPRRMAYNKLTRKKSLKLIAEERAADKYPNMEVLNSYYVGEDGLYKYFEVILVDRSHPNIFNDPHISWISEPQNTGRVYRGLTSAGYKVRGLRTGRKGSSKSRPSIRS 191          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_METMA (50S ribosomal protein L15e OS=Methanosarcina mazei GN=rpl15e PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 2.579e-27
Identity = 73/175 (41.71%), Postives = 99/175 (56.57%), Query Frame = 1
Query:   46 QRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRS-------VAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRA 549
            +R++ W  R+  S+ R+ RPTR D+AR LGYKAKQ                    G+ + +P N+G    K  ++K S       +AE RA RK   L VLNSYW+ ED  +K+FEVILVDP H  I++D  +NW+C+   + R  RG TSAG+K RG+  +G    K RPS RA
Sbjct:   27 ERLQVW--RKQGSVTRIERPTRIDRARSLGYKAKQGIVVVRVNVRRG--------GLGHVRP-NRGRRTQKMGKNKVSGGMSIQRIAEARADRKYPNLEVLNSYWVGEDGKHKWFEVILVDPHHPVIKSDKNLNWICDASIRGRATRGKTSAGRKGRGMSTRGKGTEKTRPSIRA 190          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_THEVO (50S ribosomal protein L15e OS=Thermoplasma volcanium GN=rpl15e PE=3 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 5.745e-27
Identity = 71/169 (42.01%), Postives = 93/169 (55.03%), Query Frame = 1
Query:   43 LQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRA 549
            +++ R   +R  PS+VR+  PTR D+AR LGYK+K                     G    +P      +L  ++S + +AEERA  K   L VLNSY++ ED  YKY+EVILVD +H  I NDP I+W+  P +  R  RGLTSAG K RGLR       K+RPS RA
Sbjct:   25 VEKSRMIGWRHGPSVVRLDHPTRIDRARALGYKSKDGFIVVRSRVRRGGSNREKIMG--GRRPRRLAYNKLTRKKSLKLIAEERAADKYPNLEVLNSYYVGEDGLYKYYEVILVDKSHPNIYNDPHISWISEPQNTGRVYRGLTSAGYKVRGLRTGRKGSSKSRPSIRA 191          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_UNCMA (50S ribosomal protein L15e OS=Uncultured methanogenic archaeon RC-I GN=rpl15e PE=3 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 9.799e-27
Identity = 68/169 (40.24%), Postives = 95/169 (56.21%), Query Frame = 1
Query:   55 RCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKR 561
            R  E+R+ P++V++ RPTR D+AR LGYKAKQ                         K  + G+  L  + S + +AE RA RK   + VLNSYW+ +D  +K++E+ILVDP H +I +D  ++W+    H+ R  RGLTSAGKK RG R KG    K  PS +A  +R
Sbjct:   28 RLQEWRKEPTVVKIDRPTRLDRARALGYKAKQGIIVARAHVRRGGRRKSRYSR--GRKSKHMGLRTLTRRTSIQRMAEVRASRKFPNMEVLNSYWVGQDGKHKWYEIILVDPHHPSIASDKNLSWITKGTHRGRAERGLTSAGKKGRGQRRKGKGTEKNYPSVQAHDRR 194          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_SULAC (50S ribosomal protein L15e OS=Sulfolobus acidocaldarius GN=rpl15e PE=3 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 1.280e-26
Identity = 73/180 (40.56%), Postives = 99/180 (55.00%), Query Frame = 1
Query:   19 KQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGL---RG-KGHLHHKARPSRR 546
            +  D  R + R R  E+R+ P+I R+ RPTR ++AR LGYKAKQ                         +P   GV      +  R +AEERA RK   L VL SY++ ED  YKY+EVI+VD +H  IR+DP + WL + V++ R  RGLTSAG+K RGL   RG KG +  K +  ++
Sbjct:   14 QNKDWRRSILRKRLIEWRRQPAITRIDRPTRLNRARALGYKAKQGFVMVRVRVRRGGLNKPRPNS--GRRPKRMGVYGYGPSKGYRWIAEERAARKFPNLEVLGSYYVAEDGMYKYYEVIMVDYSHPVIRSDPELKWLQDSVNRKRVFRGLTSAGQKSRGLTKSRGLKGTVQRKWKKKQK 191          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_METB6 (50S ribosomal protein L15e OS=Methanoregula boonei (strain 6A8) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 2.851e-26
Identity = 70/177 (39.55%), Postives = 97/177 (54.80%), Query Frame = 1
Query:   22 QSDVMRFL-QRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRA 549
            +SDV   L  R++ W  R+  S+ R+ RPTR D+AR LGYKAKQ                   + +   +    G       +S + +AEERA  +   + VLNSYW+ +D   KY+EVILVD  H +I++D  + WL NP H+ R  RG TSAG+K RG+R +G    K RPS R+
Sbjct:   18 KSDVKALLWDRMQVW--RREGSVTRIDRPTRIDRARALGYKAKQGIAVVRVHVRRGGRRAS--RYVRARRSARMGKNSSTPGKSIQRIAEERASVRYPNMEVLNSYWVGQDGKLKYYEVILVDGHHPSIQSDKNLAWLANPTHRGRAERGKTSAGRKGRGMRTRGRGTEKTRPSIRS 190          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_PICTO (50S ribosomal protein L15e OS=Picrophilus torridus GN=rpl15e PE=3 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 8.296e-26
Identity = 73/178 (41.01%), Postives = 101/178 (56.74%), Query Frame = 1
Query:   19 KQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHL-HHKARPSRRA 549
            K+SD+   +Q+ R   +R+  S+VR+  PTR D+AR LGYKAKQ                    G    +P      +L  ++S + +AEERA  K   + VLNSY++ ED  YKY+EVIL+D +  A+ +D  ++W+ N  +K R  RGLTSAG K RGL G G L   K+RPS RA
Sbjct:   16 KKSDIYP-VQKARMVSWRKSGSVVRLDYPTRLDRARSLGYKAKQGFIIVRSRVRKGGQHRPKIMG--GRRPRRLAYNKLTVKKSIQLIAEERAADKYPNMEVLNSYYVGEDGLYKYYEVILIDRSSPAVLSDKNVSWIANSANKGRVYRGLTSAGYKSRGL-GHGRLGSAKSRPSIRA 189          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_NANEQ (50S ribosomal protein L15e OS=Nanoarchaeum equitans GN=rpl15e PE=3 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 6.573e-23
Identity = 67/173 (38.73%), Postives = 87/173 (50.29%), Query Frame = 1
Query:   40 FLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK 558
            + QR++ W  R+ P IV V RPTR D+AR LGYK                      KG   G+             + + +AEERA R    + VL SYW+ ED  YK++EVILVDP +  I N P   WL     + R  RG TS+ +K+RGLR  G    K RPS+RA +K
Sbjct:   22 YKQRIQQW--RREPPIVEVERPTRIDRARALGYKPLPGIKIVRVRVRKGTRKREEIKG---GRRPKAEYRIRPLGVNLQWIAEERANRLHRNMEVLGSYWVGEDGLYKWYEVILVDPFNPNIYNRPEYVWLLQKNQRGRVFRGKTSSARKFRGLRNGGLGAEKVRPSKRANFK 189          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_METLZ (50S ribosomal protein L15e OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.607e-21
Identity = 64/175 (36.57%), Postives = 97/175 (55.43%), Query Frame = 1
Query:   22 QSDVMRFL-QRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQ-GVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPS 540
            +S V + L +R++ W  R+  ++VR+ RPTR D+AR LGYKAKQ                      + G+ TN+ G+ +    ++ +S+AEERA  +   + VLNSYW+ +D   KY+EVILVD    ++  D  + W+ +   + R  RG TSAG++ RGL  +G    K RPS
Sbjct:   18 ESGVKKLLWERMQTW--RRQGAVVRLERPTRIDRARELGYKAKQGIIVVRASIRRGGRRKSRY---IRGRRTNRMGMRKATPGKNLQSIAEERAATRYPNMEVLNSYWVGQDGKSKYYEVILVDRNSPSVLADKNLAWVADT--RGRVFRGKTSAGRRARGLHNRGTGTEKCRPS 185          
The following BLAST results are available for this feature:
BLAST of DC900083 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 92
Match NameE-valueIdentityDescription
RL15E_HALMA8.863e-2843.2050S ribosomal protein L15e OS=Haloarcula marismort... [more]
RL15E_THEAC2.579e-2741.2450S ribosomal protein L15e OS=Thermoplasma acidoph... [more]
RL15E_METMA2.579e-2741.7150S ribosomal protein L15e OS=Methanosarcina mazei... [more]
RL15E_THEVO5.745e-2742.0150S ribosomal protein L15e OS=Thermoplasma volcani... [more]
RL15E_UNCMA9.799e-2740.2450S ribosomal protein L15e OS=Uncultured methanoge... [more]
RL15E_SULAC1.280e-2640.5650S ribosomal protein L15e OS=Sulfolobus acidocald... [more]
RL15E_METB62.851e-2639.5550S ribosomal protein L15e OS=Methanoregula boonei... [more]
RL15E_PICTO8.296e-2641.0150S ribosomal protein L15e OS=Picrophilus torridus... [more]
RL15E_NANEQ6.573e-2338.7350S ribosomal protein L15e OS=Nanoarchaeum equitan... [more]
RL15E_METLZ3.607e-2136.5750S ribosomal protein L15e OS=Methanocorpusculum l... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900083 VSS Citrus sinensis cDNA clone VS27Q90 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900083 ID=DC900083|Name=DC900083|organism=Citrus sinensis|type=EST|length=904bp
AATTCNGCACGAGGGAAGAAGCAGTCAGATGTGATGAGGTTCTTGCAGAG
GGTGAGGTGTTGGGAGTACCGCCAACATCCATCTATTGTTAGGGTCACCC
GTCCCACTCGACCTGACAAGGCTCGACGCTTGGGTTACAAGGCCAAGCAG
GGTTATGTTGTTTATCGTGTGCGGGTAAGGCGCGGTGGTCGGAACAGGCC
TGTTCCCAAGGGCATTGTGTATGGTAAACCCACAAACCAGGGTGTTACTC
AACTGAAGTTTCAGCGCAGCAAGAGGTCTGTTGCAGAGGAGCGTGCCGGT
CGTAAGTTGGGAGGTCTTAGGGTTCTCAATTCTTACTGGATCAATGAGGA
CTCCACTTATAAGTACTTTGAGGTGATCTTGGTTGATCCTGCTCATAATG
CCATCCGTAATGACCCAAGAATTAATTGGTTATGCAATCCTGTCCATAAG
CACAGGGAACTCCGTGGTCTTACTTCTGCAGGTAAGAAGTACAGAGGCCT
ACGTGGAAAAGGACACTTGCACCACAAGGCTCGGCCTTCGCGCAGGGCTA
CCTGGAAGAGAAACAATACTCTTTCCCTCCGTCGCTACCGTTGATCATTG
TTACGGTTTTGATGTTTATCATCAGTTGAGGGATTTTGTCTGGAGGACAT
AGTAGTTGCCATTTTGAGTCTTTTAGAGATTGAAATACTATGGAACATAT
CTTATTTTGAAACCGTACATTCTAAATTAAGACATTTGTGTTTCTTGAGT
CTACCTTGAATTATAAGAGCCTTAAATGTCTCATTCTGTTTAAGGTCTTG
TTGAGTATTTGTTTCGTCACTGCTGTGATTTATCACCTCTTGAACTAGCA
GATTTTAAGTTTTGGCTCAATTTTCAATTATGAGCTTGGCTTCGAGCACA
ACCA
back to top