DC900070

Overview
NameDC900070
Unique NameDC900070
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length877
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5634 contig Csv1_Contig5634:1..876. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_PSEMY (Agmatine deiminase OS=Pseudomonas mendocina (strain ymp) GN=aguA PE=3 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 6.662e-63
Identity = 110/203 (54.19%), Postives = 148/203 (72.91%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGGSIHVDGEGT +TTEECLLN+NRNPHL++ +IE  L+ +L +  +IWLP GL+ +D+T+GH+DN CC+ +PG VLL+WTDD+ DP Y R   A+ +L    DA+GR+L + K+ +PGP++ +EEE AG++    ++ R    RLA SYVNF I NGGI+AP F D K D EA  +L Q FP++ VV +   REI+LGGG
Sbjct:  154 VLEGGSIHVDGEGTLITTEECLLNRNRNPHLSREEIEAVLREHLAIDTVIWLPEGLY-NDETDGHVDNFCCYVRPGEVLLAWTDDQNDPNYPRCQAAMRVLESVRDAKGRQLIVHKMPIPGPIHASEEECAGVDAAEGSQERSPAVRLAGSYVNFLIVNGGIVAPSFDDPK-DAEARAILQQVFPEHRVVMVP-GREILLGGG 353          

HSP 2 Score: 30.8018 bits (68), Expect = 6.662e-63
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQQPA
Sbjct:  353 GNIHCITQQQPA 364          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_PSEFS (Agmatine deiminase OS=Pseudomonas fluorescens (strain SBW25) GN=aguA PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 8.686e-63
Identity = 116/203 (57.14%), Postives = 143/203 (70.44%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGGSIHVDGEGT +TTEECLLN NRNPHL++ QIE  L A L V KIIWLP GLF +D+T+GH+DN CC+ +PG VLL+WTDD  DP Y R   A+ +L  +TDA+GR   + K+ +PGPLY TE E AG++     + R    RLA SYVNF I NGGIIAP F D   D +A  +L   FP++EVV +   RE++LGGG
Sbjct:  154 VLEGGSIHVDGEGTLITTEECLLNSNRNPHLDRAQIEAVLSANLAVDKIIWLPDGLF-NDETDGHVDNFCCYVRPGEVLLAWTDDPQDPNYARCHAAMNVLQSSTDAQGRSFTVHKMPIPGPLYATEAECAGVDPVDGTQERNPTVRLAGSYVNFLIVNGGIIAPSF-DDPLDSQAKAILQDLFPQHEVVMVP-GRELLLGGG 353          

HSP 2 Score: 30.0314 bits (66), Expect = 8.686e-63
Identity = 11/12 (91.67%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHC+TQQQPA
Sbjct:  353 GNIHCLTQQQPA 364          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_PSEF5 (Agmatine deiminase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=aguA PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 8.686e-63
Identity = 113/203 (55.67%), Postives = 147/203 (72.41%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGGSIHVDGEGT +TTEECLLN NRNPHL++ +IE  L+ +L V +I+WLP GL+ +D+T+GH+DN CC+ +PG VLL+WTDD  DP Y R   AL +L +  DA+GR  ++ K+ +PGPLY TEEE AG++    ++ R    RLA SYVNF I NGGIIAP F D   D +A  +L Q FP++EVV +   RE++LGGG
Sbjct:  154 VLEGGSIHVDGEGTLITTEECLLNHNRNPHLSREEIEAVLREHLAVEQIVWLPDGLY-NDETDGHVDNFCCYVRPGEVLLAWTDDPQDPNYPRCQAALQVLENTRDAKGRTFKVHKMPIPGPLYATEEECAGVDAVEGSQERNPSVRLAGSYVNFLIVNGGIIAPSF-DDPMDAQAKAILQQLFPEHEVVMVP-GRELLLGGG 353          

HSP 2 Score: 30.0314 bits (66), Expect = 8.686e-63
Identity = 11/12 (91.67%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHC+TQQQPA
Sbjct:  353 GNIHCLTQQQPA 364          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_SHEB5 (Putative agmatine deiminase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=aguA PE=3 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 1.133e-62
Identity = 118/204 (57.84%), Postives = 148/204 (72.55%), Query Frame = 2
Query:   14 MVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            ++LEGGSIHVDGEGTC+T+ ECLLN NRNP L K QIE+ L+ YL V + IWL  G++ D+ T+GHIDNMCCF++PG V+L WTDD+TDPQY RS  AL +L +  DA+GRKL+I  L  PGPLY TEEE+ G+  +G   PR AG RLA SYVNF I N  I+ P   D   D  A + L + FP+YE++G+  AREI+LGGG
Sbjct:  158 LILEGGSIHVDGEGTCMTSAECLLNANRNPELTKEQIEDLLRDYLNVKQFIWLQDGVYMDE-TDGHIDNMCCFARPGEVILHWTDDETDPQYPRSKAALDVLQNTVDAQGRKLKIHLLPQPGPLYCTEEESLGVT-EGTGVPRTAGERLAGSYVNFLITNNRIVFPML-DPATDDIAAQKLQEIFPEYEIIGVP-AREILLGGG 357          

HSP 2 Score: 26.5646 bits (57), Expect = 1.133e-62
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQ P+
Sbjct:  357 GNIHCITQQIPS 368          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_PSEU5 (Agmatine deiminase OS=Pseudomonas stutzeri (strain A1501) GN=aguA PE=3 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 1.477e-62
Identity = 116/203 (57.14%), Postives = 147/203 (72.41%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGGSIHVDGEGT +TTEECLLN+NRNP L++ QIE  L+ +L V  IIWLP GLF +D+T+GH+DN CCF +PG VLL+WTDD  DP Y R   A+ +L  A DA+GR L + K+ +PGPL+ ++ E AG+     ++ R    RLA SYVNF I NGGIIAP FGD   DGEA R+L + FP+++VV +   REI+LGGG
Sbjct:  154 VLEGGSIHVDGEGTLITTEECLLNRNRNPQLSREQIEAVLREHLAVDSIIWLPHGLF-NDETDGHVDNFCCFVRPGEVLLAWTDDANDPNYARCQAAMAVLQRARDAKGRALIVHKIPIPGPLHASDAECAGVVALDGSQLRDPSIRLAGSYVNFLIVNGGIIAPAFGD-PLDGEAERILREVFPEHDVVMVP-GREILLGGG 353          

HSP 2 Score: 30.8018 bits (68), Expect = 1.477e-62
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQQPA
Sbjct:  353 GNIHCITQQQPA 364          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_SHEB9 (Putative agmatine deiminase OS=Shewanella baltica (strain OS195) GN=aguA PE=3 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.925e-62
Identity = 119/204 (58.33%), Postives = 148/204 (72.55%), Query Frame = 2
Query:   14 MVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            ++LEGGSIHVDGEGTC+T+ ECLLN NRNP L K QIE+ L+ YL V + IWL  G++ D+ T+GHIDNMCCF++PG V+L WTDD+TDPQY RS  AL +L +  DA+GRKL+I  L  PGPLY TEEE+ G+  +G   PR AG RLA SYVNF I N  I+ P   D   D  A + L + FP+YE+VG+  AREI+LGGG
Sbjct:  158 LILEGGSIHVDGEGTCMTSAECLLNANRNPDLTKEQIEDLLRDYLNVKQFIWLQDGVYMDE-TDGHIDNMCCFARPGEVILHWTDDETDPQYPRSKAALDVLQNTVDAQGRKLKIHLLPQPGPLYCTEEESLGVT-EGTGVPRTAGERLAGSYVNFLITNNRIVFPLL-DPTTDDIAAQKLQEIFPEYEIVGVP-AREILLGGG 357          

HSP 2 Score: 26.5646 bits (57), Expect = 1.925e-62
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQ P+
Sbjct:  357 GNIHCITQQIPS 368          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_PSEP1 (Agmatine deiminase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=aguA PE=3 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 1.926e-62
Identity = 113/203 (55.67%), Postives = 147/203 (72.41%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGGSIHVDGEGT +TTEECLLN+NRNPHL++ QIE  L+ +L V  ++WLP GL+ +D+T+GH+DN CC+ +PG VLL+WTDD  DP Y R   A+ +L +  DA+GR+  + K+ +PGPLY T EE AG++Q   ++ R    RLA SYVNF I NGGIIAP F D   D EA  +L++ FP +EVV I   RE++LGGG
Sbjct:  154 VLEGGSIHVDGEGTVITTEECLLNRNRNPHLSREQIEAVLRDHLAVDTVVWLPDGLY-NDETDGHVDNFCCYVRPGEVLLAWTDDSNDPNYARCHAAMDVLKNTRDAKGREFIVHKMPIPGPLYATAEECAGVDQVAGSQERDPSVRLAGSYVNFLIVNGGIIAPSFDDPA-DAEARAILARIFPDHEVVMIP-GRELLLGGG 353          

HSP 2 Score: 30.0314 bits (66), Expect = 1.926e-62
Identity = 11/12 (91.67%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHC+TQQQPA
Sbjct:  353 GNIHCLTQQQPA 364          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_ERWCT (Putative agmatine deiminase OS=Erwinia carotovora subsp. atroseptica GN=aguA PE=3 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 2.511e-62
Identity = 121/204 (59.31%), Postives = 151/204 (74.02%), Query Frame = 2
Query:   14 MVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            ++LEGGSIHVDGEGT LTT ECLLN NRNPHL+K +IE  ++ YL +  IIWL  G++ +D+T+GHIDNMCCF +PG V L WTDD+ DPQY RSV A  +LS A DA+GR+L+I KL  PGPL+ T+EEA G++  G+A  RLAG+RLA SYVNF I+N  II P   D+K D  A  +L Q FP Y + G+  AREI+LGGG
Sbjct:  156 LILEGGSIHVDGEGTLLTTAECLLNPNRNPHLSKAEIEQLMRDYLSISTIIWLEEGVY-NDETDGHIDNMCCFVRPGEVALHWTDDENDPQYARSVAAYEVLSAARDAQGRELKIWKLPAPGPLHATKEEAQGVD-SGDAVERLAGSRLAGSYVNFLISNQQIIFPLL-DEKTDDVARDLLQQMFPDYLISGVP-AREILLGGG 355          

HSP 2 Score: 26.1794 bits (56), Expect = 2.511e-62
Identity = 10/11 (90.91%), Postives = 10/11 (90.91%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            GNIHCITQQ P
Sbjct:  355 GNIHCITQQIP 365          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_PSEPG (Agmatine deiminase OS=Pseudomonas putida (strain GB-1) GN=aguA PE=3 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 2.511e-62
Identity = 113/203 (55.67%), Postives = 146/203 (71.92%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGGSIHVDGEGT +TTEECLLN+NRNPH+N+ QIE  L+  L V  ++WLP GLF +D+T+GH+DN CC+ +PG VLL+WTDD  DP Y R   A+ +L +  DA+GR+  + K+ +PGPL+ T EE AG++Q   ++ R    RLA SYVNF I NGGIIAP F D   D EA  +L++ FP +EVV I   RE++LGGG
Sbjct:  154 VLEGGSIHVDGEGTVITTEECLLNRNRNPHMNREQIEAVLRDQLAVDTVVWLPDGLF-NDETDGHVDNFCCYVRPGEVLLAWTDDSNDPNYARCHAAMEVLKNTRDAKGREFIVHKMPIPGPLFATAEECAGVDQVAGSQERDPSVRLAGSYVNFLIVNGGIIAPSFDDPA-DAEARAILAKIFPDHEVVMIP-GRELLLGGG 353          

HSP 2 Score: 30.0314 bits (66), Expect = 2.511e-62
Identity = 11/12 (91.67%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHC+TQQQPA
Sbjct:  353 GNIHCLTQQQPA 364          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_PSE14 (Agmatine deiminase OS=Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) GN=aguA PE=3 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 3.274e-62
Identity = 116/203 (57.14%), Postives = 145/203 (71.43%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGGSIHVDGEGT +TTEECLLN+NRNPHL + QIE  L  YL V K++WLP GLF +D+T+GH+DN CC+ +PG VLL+WTDD  DP Y R   AL IL +  DA+GR   + K+ +PGPL+ TEEE AG++Q   ++ R    RLA SYVNF I NGGIIAP F D   D +A  +L   FP++EVV +   RE++LGGG
Sbjct:  154 VLEGGSIHVDGEGTLITTEECLLNRNRNPHLTREQIEAILGDYLAVDKVVWLPDGLF-NDETDGHVDNFCCYIRPGEVLLAWTDDPEDPNYSRCHAALGILENTLDAKGRAFIVHKMPIPGPLFATEEECAGVDQVHGSQERNPSVRLAGSYVNFLIVNGGIIAPSF-DDPMDEKARELLQTLFPEHEVV-MAPGRELLLGGG 353          

HSP 2 Score: 30.0314 bits (66), Expect = 3.274e-62
Identity = 11/12 (91.67%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHC+TQQQPA
Sbjct:  353 GNIHCLTQQQPA 364          
The following BLAST results are available for this feature:
BLAST of DC900070 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 59
Match NameE-valueIdentityDescription
AGUA_PSEMY6.662e-6354.19Agmatine deiminase OS=Pseudomonas mendocina (strai... [more]
AGUA_PSEFS8.686e-6357.14Agmatine deiminase OS=Pseudomonas fluorescens (str... [more]
AGUA_PSEF58.686e-6355.67Agmatine deiminase OS=Pseudomonas fluorescens (str... [more]
AGUA_SHEB51.133e-6257.84Putative agmatine deiminase OS=Shewanella baltica ... [more]
AGUA_PSEU51.477e-6257.14Agmatine deiminase OS=Pseudomonas stutzeri (strain... [more]
AGUA_SHEB91.925e-6258.33Putative agmatine deiminase OS=Shewanella baltica ... [more]
AGUA_PSEP11.926e-6255.67Agmatine deiminase OS=Pseudomonas putida (strain F... [more]
AGUA_ERWCT2.511e-6259.31Putative agmatine deiminase OS=Erwinia carotovora ... [more]
AGUA_PSEPG2.511e-6255.67Agmatine deiminase OS=Pseudomonas putida (strain G... [more]
AGUA_PSE143.274e-6257.14Agmatine deiminase OS=Pseudomonas syringae pv. pha... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900070 VSS Citrus sinensis cDNA clone VS27Q75 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900070 ID=DC900070|Name=DC900070|organism=Citrus sinensis|type=EST|length=877bp
ATTTCCACATTCTATGGTTCTCGAAGGGGGAAGCATCCATGTGGATGGAG
AAGGTACATGCTTAACTACAGAGGAGTGCCTCTTGAACAAAAACAGGAAC
CCACATTTGAACAAAGGACAAATAGAGAACGAACTTAAGGCATATCTTGG
AGTCATGAAGATTATATGGTTGCCTCGTGGATTATTTGGTGATGATGATA
CTAATGGCCATATTGACAATATGTGCTGTTTTTCAAAGCCTGGTGTGGTG
TTACTGTCTTGGACTGATGATAAAACAGATCCTCAGTACGAACGATCTGT
GGAGGCGTTGACTATTCTCTCTGATGCTACTGATGCCAGAGGTCGGAAAT
TACAAATAATTAAACTTCATGTACCAGGGCCACTTTATATGACAGAAGAA
GAAGCTGCTGGACTTAATCAGGATGGTGAGGCTAAACCAAGACTTGCGGG
TACAAGACTTGCTGCTTCATATGTGAATTTCTACATTGCAAATGGAGGAA
TCATCGCACCACAGTTTGGGGACAAAAAGTGGGACGGTGAAGCTGTTCGT
GTCCTGTCTCAAGCCTTTCCTAAGTATGAAGTGGTAGGAATTGAAAGAGC
AAGGGAAATTGTTTTGGGAGGTGGGAAATATACATTGCATTACTCAACAA
CAACCAGCCATTCCAACAAATGCTGCGAAGCTAGACTGATTAGATACTGA
AATTATAACTGTNAANTCAGAGGCAGCAGCGTTGATCTCCAGATTGAGCA
TGTGTGTTTTTAAGAGGACATAATTTAAGCATTTGACAGTTAGTAGCTCT
GTGGGAATCCTGATGATTGATTGGCAAACACTGTCTTAAATAACATATGA
TAAAGCTTAAGCAAAATCAAAGGAAAA
back to top