DC900070

Overview
NameDC900070
Unique NameDC900070
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length877
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5634 contig Csv1_Contig5634:1..876. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_PHOPR (Putative agmatine deiminase OS=Photobacterium profundum GN=aguA PE=3 SV=2)

HSP 1 Score: 207.223 bits (526), Expect = 5.928e-55
Identity = 105/204 (51.47%), Postives = 148/204 (72.55%), Query Frame = 2
Query:   14 MVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            +VLEGGSIHVDGEGT  TTEECLL+ +RNP L + +IE+ LK  L + K+IW+P+GL+ +D+TNGH+DN+    +PG + L+W DD+TDPQY  S +A+ +L   TDA+GR+++I KL +PGPLY++E+EA G++   E   R+ G RLA SY N+ I+N  II P   D+K D +   +L++ +P YEV G+  AREI+LGGG
Sbjct:  152 IVLEGGSIHVDGEGTLYTTEECLLHPSRNPDLTREEIEDVLKVTLSIEKVIWIPQGLY-NDETNGHVDNLIHVVRPGEIALTWCDDETDPQYLISRKAMDVLLTETDAKGRQIKIHKLPMPGPLYISEDEANGVDV-SEGMERVPGERLAGSYANYLISNEHIIYPLL-DEKHDKDVAMLLAKLYPNYEVTGV-NAREILLGGG 351          

HSP 2 Score: 26.9498 bits (58), Expect = 5.928e-55
Identity = 10/13 (76.92%), Postives = 11/13 (84.62%), Query Frame = 3
Query:  624 GNIHCITQQQPAI 662
            GNIHCITQQ P +
Sbjct:  351 GNIHCITQQIPKV 363          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_STRZP (Putative agmatine deiminase OS=Streptococcus pneumoniae (strain P1031) GN=aguA PE=3 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.527e-49
Identity = 106/205 (51.71%), Postives = 137/205 (66.83%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPG-PLYMTEEEAAG-LNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGG+IH DG+GT L TE CLL+  RNP+L K +IEN L   LG  K+IWLP G++  D+TN H+DN+  F  P  ++L+WTDD+ DPQY  S   L +L   TDA+G    I KL +P     +TEE+  G + ++GE K R AG RLAASYVNFYIAN  ++ PQF D   D  A+ +LS+ FP  +VVGI  AR+I+LGGG
Sbjct:  150 VLEGGAIHSDGQGTILVTESCLLSPGRNPNLTKEEIENTLLESLGAEKVIWLPYGIY-QDETNEHVDNVAAFVGPAELVLAWTDDENDPQYAMSKADLELLEQETDAKGCHFTIHKLPIPAVRQVVTEEDLPGYIYEEGEEK-RYAGERLAASYVNFYIANKAVLVPQFEDVN-DQVALDILSKCFPDRKVVGIP-ARDILLGGG 350          

HSP 2 Score: 26.1794 bits (56), Expect = 1.527e-49
Identity = 10/11 (90.91%), Postives = 10/11 (90.91%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            GNIHCITQQ P
Sbjct:  350 GNIHCITQQIP 360          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_STRZJ (Putative agmatine deiminase OS=Streptococcus pneumoniae (strain JJA) GN=aguA PE=3 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.527e-49
Identity = 106/205 (51.71%), Postives = 137/205 (66.83%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPG-PLYMTEEEAAG-LNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGG+IH DG+GT L TE CLL+  RNP+L K +IEN L   LG  K+IWLP G++  D+TN H+DN+  F  P  ++L+WTDD+ DPQY  S   L +L   TDA+G    I KL +P     +TEE+  G + ++GE K R AG RLAASYVNFYIAN  ++ PQF D   D  A+ +LS+ FP  +VVGI  AR+I+LGGG
Sbjct:  150 VLEGGAIHSDGQGTILVTESCLLSPGRNPNLTKEEIENTLLESLGAEKVIWLPYGIY-QDETNEHVDNVAAFVGPAELVLAWTDDENDPQYAMSKADLELLEQETDAKGCHFTIHKLPIPAVRQVVTEEDLPGYIYEEGEEK-RYAGERLAASYVNFYIANKAVLVPQFEDVN-DQVALDILSKCFPDRKVVGIP-ARDILLGGG 350          

HSP 2 Score: 26.1794 bits (56), Expect = 1.527e-49
Identity = 10/11 (90.91%), Postives = 10/11 (90.91%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            GNIHCITQQ P
Sbjct:  350 GNIHCITQQIP 360          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_STRPN (Putative agmatine deiminase OS=Streptococcus pneumoniae GN=aguA PE=3 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.527e-49
Identity = 106/205 (51.71%), Postives = 137/205 (66.83%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPG-PLYMTEEEAAG-LNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGG+IH DG+GT L TE CLL+  RNP+L K +IEN L   LG  K+IWLP G++  D+TN H+DN+  F  P  ++L+WTDD+ DPQY  S   L +L   TDA+G    I KL +P     +TEE+  G + ++GE K R AG RLAASYVNFYIAN  ++ PQF D   D  A+ +LS+ FP  +VVGI  AR+I+LGGG
Sbjct:  150 VLEGGAIHSDGQGTILVTESCLLSPGRNPNLTKEEIENTLLESLGAEKVIWLPYGIY-QDETNEHVDNVAAFVGPAELVLAWTDDENDPQYAMSKADLELLEQETDAKGCHFTIHKLPIPAVRQVVTEEDLPGYIYEEGEEK-RYAGERLAASYVNFYIANKAVLVPQFEDVN-DQVALDILSKCFPDRKVVGIP-ARDILLGGG 350          

HSP 2 Score: 26.1794 bits (56), Expect = 1.527e-49
Identity = 10/11 (90.91%), Postives = 10/11 (90.91%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            GNIHCITQQ P
Sbjct:  350 GNIHCITQQIP 360          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_STRPI (Putative agmatine deiminase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=aguA PE=3 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.527e-49
Identity = 104/204 (50.98%), Postives = 133/204 (65.20%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPG-PLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGG+IH DG+GT L TE CLL+  RNP+L K +IEN L   LG  K+IWLP G++  D+TN H+DN+  F  P  V+L+WTDD+ DPQY  S   L +L   TDA+G    I KL +P     +TEE+  G   +   + R AG RLAASYVNFYIAN  ++ PQF D   D  A+ +LS+ FP  +VVGI  AR+I+LGGG
Sbjct:  150 VLEGGAIHSDGQGTILVTESCLLSPGRNPNLTKEEIENTLLESLGAEKVIWLPYGIY-QDETNEHVDNVAAFVGPAEVVLAWTDDENDPQYAMSKADLELLEQETDAKGCHFTIHKLPIPAVRQVVTEEDLPGYIYEEGEEERYAGERLAASYVNFYIANKAVLVPQFEDVN-DQVALDILSKCFPDRKVVGIP-ARDILLGGG 350          

HSP 2 Score: 26.1794 bits (56), Expect = 1.527e-49
Identity = 10/11 (90.91%), Postives = 10/11 (90.91%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            GNIHCITQQ P
Sbjct:  350 GNIHCITQQIP 360          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_STRP7 (Putative agmatine deiminase OS=Streptococcus pneumoniae (strain 70585) GN=aguA PE=3 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.527e-49
Identity = 106/205 (51.71%), Postives = 137/205 (66.83%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPG-PLYMTEEEAAG-LNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGG+IH DG+GT L TE CLL+  RNP+L K +IEN L   LG  K+IWLP G++  D+TN H+DN+  F  P  ++L+WTDD+ DPQY  S   L +L   TDA+G    I KL +P     +TEE+  G + ++GE K R AG RLAASYVNFYIAN  ++ PQF D   D  A+ +LS+ FP  +VVGI  AR+I+LGGG
Sbjct:  150 VLEGGAIHSDGQGTILVTESCLLSPGRNPNLTKEEIENTLLESLGAEKVIWLPYGIY-QDETNEHVDNVAAFVGPAELVLAWTDDENDPQYAMSKADLELLEQETDAKGCHFTIHKLPIPAVRQVVTEEDLPGYIYEEGEEK-RYAGERLAASYVNFYIANKAVLVPQFEDVN-DQVALDILSKCFPDRKVVGIP-ARDILLGGG 350          

HSP 2 Score: 26.1794 bits (56), Expect = 1.527e-49
Identity = 10/11 (90.91%), Postives = 10/11 (90.91%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            GNIHCITQQ P
Sbjct:  350 GNIHCITQQIP 360          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_STRR6 (Putative agmatine deiminase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=aguA PE=3 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.990e-49
Identity = 104/204 (50.98%), Postives = 133/204 (65.20%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPG-PLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGG+IH DG+GT L TE CLL+  RNP+L K +IEN L   LG  K+IWLP G++  D+TN H+DN+  F  P  V+L+WTDD+ DPQY  S   L +L   TDA+G    I KL +P     +TEE+  G   +   + R AG RLAASYVNFYIAN  ++ PQF D   D  A+ +LS+ FP  +VVGI  AR+I+LGGG
Sbjct:  150 VLEGGAIHSDGQGTILVTESCLLSPGRNPNLTKEEIENTLLESLGAEKVIWLPYGIY-QDETNEHVDNVVAFVGPAEVVLAWTDDENDPQYAMSKADLELLEQETDAKGCHFTIHKLPIPAVRQVVTEEDLPGYIYEEGEEERYAGERLAASYVNFYIANKAVLVPQFEDVN-DQVALDILSKCFPDRKVVGIP-ARDILLGGG 350          

HSP 2 Score: 26.1794 bits (56), Expect = 1.990e-49
Identity = 10/11 (90.91%), Postives = 10/11 (90.91%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            GNIHCITQQ P
Sbjct:  350 GNIHCITQQIP 360          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_STRPS (Putative agmatine deiminase OS=Streptococcus pneumoniae (strain CGSP14) GN=aguA PE=3 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.990e-49
Identity = 104/204 (50.98%), Postives = 133/204 (65.20%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPG-PLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGG+IH DG+GT L TE CLL+  RNP+L K +IEN L   LG  K+IWLP G++  D+TN H+DN+  F  P  V+L+WTDD+ DPQY  S   L +L   TDA+G    I KL +P     +TEE+  G   +   + R AG RLAASYVNFYIAN  ++ PQF D   D  A+ +LS+ FP  +VVGI  AR+I+LGGG
Sbjct:  150 VLEGGAIHSDGQGTILVTESCLLSPGRNPNLTKEEIENTLLESLGAEKVIWLPYGIY-QDETNEHVDNVVAFVGPAEVVLAWTDDENDPQYAMSKADLELLEQETDAKGCHFTIHKLPIPAVRQVVTEEDLPGYIYEEGEEERYAGERLAASYVNFYIANKAVLVPQFEDVN-DQVALDILSKCFPDRKVVGIP-ARDILLGGG 350          

HSP 2 Score: 26.1794 bits (56), Expect = 1.990e-49
Identity = 10/11 (90.91%), Postives = 10/11 (90.91%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            GNIHCITQQ P
Sbjct:  350 GNIHCITQQIP 360          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_STRPJ (Putative agmatine deiminase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=aguA PE=3 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.990e-49
Identity = 104/204 (50.98%), Postives = 133/204 (65.20%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPG-PLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGG+IH DG+GT L TE CLL+  RNP+L K +IEN L   LG  K+IWLP G++  D+TN H+DN+  F  P  V+L+WTDD+ DPQY  S   L +L   TDA+G    I KL +P     +TEE+  G   +   + R AG RLAASYVNFYIAN  ++ PQF D   D  A+ +LS+ FP  +VVGI  AR+I+LGGG
Sbjct:  150 VLEGGAIHSDGQGTILVTESCLLSPGRNPNLTKEEIENTLLESLGAEKVIWLPYGIY-QDETNEHVDNVVAFVGPAEVVLAWTDDENDPQYAMSKADLELLEQETDAKGCHFTIHKLPIPAVRQVVTEEDLPGYIYEEGEEERYAGERLAASYVNFYIANKAVLVPQFEDVN-DQVALDILSKCFPDRKVVGIP-ARDILLGGG 350          

HSP 2 Score: 26.1794 bits (56), Expect = 1.990e-49
Identity = 10/11 (90.91%), Postives = 10/11 (90.91%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            GNIHCITQQ P
Sbjct:  350 GNIHCITQQIP 360          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_STRP2 (Putative agmatine deiminase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=aguA PE=3 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.990e-49
Identity = 104/204 (50.98%), Postives = 133/204 (65.20%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPG-PLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGG+IH DG+GT L TE CLL+  RNP+L K +IEN L   LG  K+IWLP G++  D+TN H+DN+  F  P  V+L+WTDD+ DPQY  S   L +L   TDA+G    I KL +P     +TEE+  G   +   + R AG RLAASYVNFYIAN  ++ PQF D   D  A+ +LS+ FP  +VVGI  AR+I+LGGG
Sbjct:  150 VLEGGAIHSDGQGTILVTESCLLSPGRNPNLTKEEIENTLLESLGAEKVIWLPYGIY-QDETNEHVDNVVAFVGPAEVVLAWTDDENDPQYAMSKADLELLEQETDAKGCHFTIHKLPIPAVRQVVTEEDLPGYIYEEGEEERYAGERLAASYVNFYIANKAVLVPQFEDVN-DQVALDILSKCFPDRKVVGIP-ARDILLGGG 350          

HSP 2 Score: 26.1794 bits (56), Expect = 1.990e-49
Identity = 10/11 (90.91%), Postives = 10/11 (90.91%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            GNIHCITQQ P
Sbjct:  350 GNIHCITQQIP 360          
The following BLAST results are available for this feature:
BLAST of DC900070 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 59
Match NameE-valueIdentityDescription
AGUA_PHOPR5.928e-5551.47Putative agmatine deiminase OS=Photobacterium prof... [more]
AGUA_STRZP1.527e-4951.71Putative agmatine deiminase OS=Streptococcus pneum... [more]
AGUA_STRZJ1.527e-4951.71Putative agmatine deiminase OS=Streptococcus pneum... [more]
AGUA_STRPN1.527e-4951.71Putative agmatine deiminase OS=Streptococcus pneum... [more]
AGUA_STRPI1.527e-4950.98Putative agmatine deiminase OS=Streptococcus pneum... [more]
AGUA_STRP71.527e-4951.71Putative agmatine deiminase OS=Streptococcus pneum... [more]
AGUA_STRR61.990e-4950.98Putative agmatine deiminase OS=Streptococcus pneum... [more]
AGUA_STRPS1.990e-4950.98Putative agmatine deiminase OS=Streptococcus pneum... [more]
AGUA_STRPJ1.990e-4950.98Putative agmatine deiminase OS=Streptococcus pneum... [more]
AGUA_STRP21.990e-4950.98Putative agmatine deiminase OS=Streptococcus pneum... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900070 VSS Citrus sinensis cDNA clone VS27Q75 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900070 ID=DC900070|Name=DC900070|organism=Citrus sinensis|type=EST|length=877bp
ATTTCCACATTCTATGGTTCTCGAAGGGGGAAGCATCCATGTGGATGGAG
AAGGTACATGCTTAACTACAGAGGAGTGCCTCTTGAACAAAAACAGGAAC
CCACATTTGAACAAAGGACAAATAGAGAACGAACTTAAGGCATATCTTGG
AGTCATGAAGATTATATGGTTGCCTCGTGGATTATTTGGTGATGATGATA
CTAATGGCCATATTGACAATATGTGCTGTTTTTCAAAGCCTGGTGTGGTG
TTACTGTCTTGGACTGATGATAAAACAGATCCTCAGTACGAACGATCTGT
GGAGGCGTTGACTATTCTCTCTGATGCTACTGATGCCAGAGGTCGGAAAT
TACAAATAATTAAACTTCATGTACCAGGGCCACTTTATATGACAGAAGAA
GAAGCTGCTGGACTTAATCAGGATGGTGAGGCTAAACCAAGACTTGCGGG
TACAAGACTTGCTGCTTCATATGTGAATTTCTACATTGCAAATGGAGGAA
TCATCGCACCACAGTTTGGGGACAAAAAGTGGGACGGTGAAGCTGTTCGT
GTCCTGTCTCAAGCCTTTCCTAAGTATGAAGTGGTAGGAATTGAAAGAGC
AAGGGAAATTGTTTTGGGAGGTGGGAAATATACATTGCATTACTCAACAA
CAACCAGCCATTCCAACAAATGCTGCGAAGCTAGACTGATTAGATACTGA
AATTATAACTGTNAANTCAGAGGCAGCAGCGTTGATCTCCAGATTGAGCA
TGTGTGTTTTTAAGAGGACATAATTTAAGCATTTGACAGTTAGTAGCTCT
GTGGGAATCCTGATGATTGATTGGCAAACACTGTCTTAAATAACATATGA
TAAAGCTTAAGCAAAATCAAAGGAAAA
back to top