DC900070

Overview
NameDC900070
Unique NameDC900070
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length877
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5634 contig Csv1_Contig5634:1..876. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_STRZT (Putative agmatine deiminase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=aguA PE=3 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.658e-48
Identity = 102/204 (50.00%), Postives = 132/204 (64.71%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPG-PLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGG+IH DG+GT L TE CLL+  RNP+L K +IEN L   LG  K+IWLP G++  D+TN H+DN+  F     ++L+WTDD+ DPQY  S   L +L   TDA+G    I KL +P     +TEE+  G   +   + R AG RLAASYVNFYIAN  ++ PQF D   D  A+ +LS+ FP  +VVGI  AR+I+LGGG
Sbjct:  150 VLEGGAIHSDGQGTILVTESCLLSPGRNPNLTKEEIENTLLESLGAEKVIWLPYGIY-QDETNEHVDNVAAFVGSAELVLAWTDDENDPQYAMSKADLELLEQETDAKGCHFTIHKLPIPAVRQVVTEEDLPGYIYEEGEEERYAGERLAASYVNFYIANKAVLVPQFEDVN-DQVAIDILSKCFPDRKVVGIP-ARDILLGGG 350          

HSP 2 Score: 26.1794 bits (56), Expect = 1.658e-48
Identity = 10/11 (90.91%), Postives = 10/11 (90.91%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            GNIHCITQQ P
Sbjct:  350 GNIHCITQQIP 360          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_STRMU (Putative agmatine deiminase OS=Streptococcus mutans GN=aguA PE=1 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 5.190e-47
Identity = 99/204 (48.53%), Postives = 132/204 (64.71%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHV-PGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGGSIHVDGEGT L TE CLL+ +RNPHL K  IE++LK YL  +K++W+  G+    +TNGHID++ CF +PG V   +TDDK  P Y+ +  A   LS  TDA+GR L++ K+ V   P Y+  +EAA ++    + PR  G    ASY+NF I NGGII PQ+GD+  D  A + + + FP  +VVG+ R  EI  GGG
Sbjct:  159 VLEGGSIHVDGEGTVLVTEMCLLHPSRNPHLTKEDIEDKLKDYLNCVKVLWVKDGI-DPYETNGHIDDVACFIRPGEVACIYTDDKEHPFYQEAKAAYDFLSQQTDAKGRPLKVHKMCVTKEPCYL--QEAATIDYVEGSIPREEGEMAIASYLNFLIVNGGIILPQYGDEN-DQLAKQQVQEMFPDRKVVGV-RTEEIAYGGG 357          

HSP 2 Score: 30.8018 bits (68), Expect = 5.190e-47
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQQPA
Sbjct:  357 GNIHCITQQQPA 368          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_LACLA (Putative agmatine deiminase OS=Lactococcus lactis subsp. lactis GN=aguA PE=3 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 2.295e-44
Identity = 90/203 (44.33%), Postives = 130/203 (64.04%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGGS HVDG+GT LTTE CLL++ RNPH++K  IEN+LK +L   KI+WL  G+   ++TNGH+D++ CF  PG V   +T+D+  P YE + +A   L+  TDA+GR+L++ KL  P    +T ++   ++      PR  G    ASY+NF I N G+I PQ+GD+  D  A++ + + FP  E+VG+    E+V GGG
Sbjct:  155 VLEGGSFHVDGQGTVLTTEMCLLSEGRNPHMSKEDIENKLKEHLNAEKILWLGDGI-DPEETNGHVDDVACFVAPGEVACIYTEDEKSPFYEAAQDAYKRLNQMTDAKGRQLKVHKLTCPAK-NVTIKKQFRIDTVEGTMPREDGDICIASYMNFLITNKGVIVPQYGDEN-DALALKQVQEMFPDREIVGVNTV-EVVYGGG 353          

HSP 2 Score: 29.261 bits (64), Expect = 2.295e-44
Identity = 11/11 (100.00%), Postives = 11/11 (100.00%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            GNIHCITQQQP
Sbjct:  353 GNIHCITQQQP 363          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_LEGPA (Putative agmatine deiminase OS=Legionella pneumophila (strain Paris) GN=aguA PE=3 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 5.082e-44
Identity = 94/208 (45.19%), Postives = 121/208 (58.17%), Query Frame = 2
Query:    2 FPHSMVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            F   +V+EGGS HVDGEGT LT++ECLLN NRNPHL++ +IE  L  YLG  +IIWL  GL G D+T+GHID +  F  PG VL   T DK DP Y R  E   IL  + DARGR  ++  +  P   Y                  L G RL  SY+NFY+AN GI+ P FG + +D  A ++  Q FP Y++  I+ A ++  GGG
Sbjct:  142 FHAPLVMEGGSFHVDGEGTILTSKECLLNSNRNPHLSQQEIEQYLINYLGAERIIWLNMGLIG-DETDGHIDEIATFIAPGKVLCLITKDKEDPNYHRLQENFEILKSSKDARGRTFEVYTVEQPPATY------------------LNGERLTLSYINFYMANQGIVMPAFGYESFDRLAYQLFVQIFPGYQITQID-ALDVFSGGG 329          

HSP 2 Score: 26.9498 bits (58), Expect = 5.082e-44
Identity = 10/11 (90.91%), Postives = 10/11 (90.91%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            G IHCITQQQP
Sbjct:  329 GGIHCITQQQP 339          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_LEGPH (Putative agmatine deiminase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=aguA PE=3 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 6.622e-44
Identity = 93/208 (44.71%), Postives = 121/208 (58.17%), Query Frame = 2
Query:    2 FPHSMVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            F   +V+EGGS HVDGEGT LT++ECLLN NRNPHL++ +IE  L  YLG  +IIWL  GL G D+T+GH+D +  F  PG VL   T DK DP Y R  E   IL  + DARGR  ++  +  P   Y                  L G RL  SY+NFY+AN GI+ P FG + +D  A ++  Q FP Y++  I+ A ++  GGG
Sbjct:  144 FHAPLVMEGGSFHVDGEGTILTSKECLLNSNRNPHLSQQEIEQYLINYLGAERIIWLNMGLIG-DETDGHVDEIATFIAPGKVLCLITKDKEDPNYHRLQENFEILKSSKDARGRTFEVYTVEQPPATY------------------LNGERLTLSYINFYMANQGIVMPAFGYESFDRLAYQLFVQIFPGYQITQID-ALDVFSGGG 331          

HSP 2 Score: 26.9498 bits (58), Expect = 6.622e-44
Identity = 10/11 (90.91%), Postives = 10/11 (90.91%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            G IHCITQQQP
Sbjct:  331 GGIHCITQQQP 341          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_LEGPL (Putative agmatine deiminase OS=Legionella pneumophila (strain Lens) GN=aguA PE=3 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 6.623e-44
Identity = 93/208 (44.71%), Postives = 121/208 (58.17%), Query Frame = 2
Query:    2 FPHSMVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            F   +V+EGGS HVDGEGT LT++ECLLN NRNPHL++ +IE  L  YLG  +IIWL  GL G D+T+GH+D +  F  PG VL   T DK DP Y R  E   IL  + DARGR  ++  +  P   Y                  L G RL  SY+NFY+AN GI+ P FG + +D  A ++  Q FP Y++  I+ A ++  GGG
Sbjct:  142 FHAPLVMEGGSFHVDGEGTILTSKECLLNSNRNPHLSQQEIEQYLINYLGAERIIWLNMGLIG-DETDGHVDEIATFIAPGKVLCLITKDKEDPNYHRLQENFEILKSSKDARGRTFEVYTVEQPPATY------------------LNGERLTLSYINFYMANQGIVMPAFGYESFDRLAYQLFVQIFPGYQITQID-ALDVFSGGG 329          

HSP 2 Score: 26.9498 bits (58), Expect = 6.623e-44
Identity = 10/11 (90.91%), Postives = 10/11 (90.91%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            G IHCITQQQP
Sbjct:  329 GGIHCITQQQP 339          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_ENTFA (Putative agmatine deiminase OS=Enterococcus faecalis GN=aguA PE=1 SV=2)

HSP 1 Score: 156.377 bits (394), Expect = 4.114e-40
Identity = 88/203 (43.35%), Postives = 125/203 (61.58%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGGS HVDG+GT LTTE CLL++ RNP L+K  IE +L  YL V K++WL  G+   ++TNGH+D++ CF  PG V   +T+D+  P YE + +A   L   TDA+GR+L++ KL  P    +T + +  ++      PR  G    ASY+NF I N G+I PQ+GD+  D  A+  +   FP  ++VG+    E+V GGG
Sbjct:  155 VLEGGSFHVDGQGTVLTTEMCLLSEGRNPQLSKEAIEQKLCDYLNVEKVLWLGDGI-DPEETNGHVDDVACFIAPGEVACIYTEDQNSPFYEAAQDAYQRLLKMTDAKGRQLKVHKLCCP-VKNVTIKGSFKIDFVEGTMPREDGDICIASYMNFLITNDGVIVPQYGDEN-DHLALEQVQTMFPDKKIVGVNTV-EVVYGGG 353          

HSP 2 Score: 28.1054 bits (61), Expect = 4.114e-40
Identity = 10/11 (90.91%), Postives = 11/11 (100.00%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            GNIHCITQQ+P
Sbjct:  353 GNIHCITQQEP 363          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_STRAW (Putative agmatine deiminase OS=Streptomyces avermitilis GN=aguA PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 3.195e-33
Identity = 84/213 (39.44%), Postives = 115/213 (53.99%), Query Frame = 2
Query:    2 FPHSMVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGD-----DDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            +   +V EGG+IHVDGEGT L TE   L   RNP   + Q+E E+ A+LG  K IWLPRGL GD       T GH+D +  F++PGVV+     D   P +E S E + +L  ATDA GR++++++  VP P   T  EA G   D              SY+N Y+ NGG++   F D + D  A  +  + FP+  V  ++ AR I  GGG
Sbjct:  142 YASKLVNEGGAIHVDGEGTVLLTETVQLGAERNPGWTREQVETEIHAHLGTSKAIWLPRGLTGDYPPHGFGTLGHVDIVAAFARPGVVVAHHQPDPAHPDHEVSKEVIGLLKAATDAHGRRIEVVE--VPAP---TVLEADGHWAD-------------YSYINHYLCNGGVVLCGFDDPR-DETAAGIFRRLFPERTVTLVD-ARTIFSGGG 334          

HSP 2 Score: 26.9498 bits (58), Expect = 3.195e-33
Identity = 10/11 (90.91%), Postives = 10/11 (90.91%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            G IHCITQQQP
Sbjct:  334 GGIHCITQQQP 344          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_STRCO (Putative agmatine deiminase OS=Streptomyces coelicolor GN=aguA PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 3.196e-33
Identity = 81/207 (39.13%), Postives = 112/207 (54.11%), Query Frame = 2
Query:   14 MVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGD---DDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            +V EGG+IHVDGEGT L T+   L   RNP  ++ ++E E+ A LG    IWLP GL GD     T GH+D +  F++PG V++    D   P +ERS   L IL   TDARGR+L++++  VP P  + +EE               G     SY+N Y+ NGG++   FGD   D  A  +  + FP+  V  ++ AR I  GGG
Sbjct:  140 LVNEGGAIHVDGEGTVLLTDTVQLGSGRNPGWSREEVEAEIHAKLGTTTAIWLPHGLAGDYGRYGTQGHVDIVAAFARPGTVVVHSQRDPRHPDHERSQLYLEILRGRTDARGRRLEVVE--VPAPTVLKDEE---------------GEWADYSYINHYVCNGGVVLCAFGDPN-DELAAGIFRRLFPERTVTLVD-ARTIFAGGG 327          

HSP 2 Score: 26.9498 bits (58), Expect = 3.196e-33
Identity = 10/11 (90.91%), Postives = 10/11 (90.91%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            G IHCITQQQP
Sbjct:  327 GGIHCITQQQP 337          
The following BLAST results are available for this feature:
BLAST of DC900070 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 59
Match NameE-valueIdentityDescription
AGUA_STRZT1.658e-4850.00Putative agmatine deiminase OS=Streptococcus pneum... [more]
AGUA_STRMU5.190e-4748.53Putative agmatine deiminase OS=Streptococcus mutan... [more]
AGUA_LACLA2.295e-4444.33Putative agmatine deiminase OS=Lactococcus lactis ... [more]
AGUA_LEGPA5.082e-4445.19Putative agmatine deiminase OS=Legionella pneumoph... [more]
AGUA_LEGPH6.622e-4444.71Putative agmatine deiminase OS=Legionella pneumoph... [more]
AGUA_LEGPL6.623e-4444.71Putative agmatine deiminase OS=Legionella pneumoph... [more]
AGUA_ENTFA4.114e-4043.35Putative agmatine deiminase OS=Enterococcus faecal... [more]
AGUA_STRAW3.195e-3339.44Putative agmatine deiminase OS=Streptomyces avermi... [more]
AGUA_STRCO3.196e-3339.13Putative agmatine deiminase OS=Streptomyces coelic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900070 VSS Citrus sinensis cDNA clone VS27Q75 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900070 ID=DC900070|Name=DC900070|organism=Citrus sinensis|type=EST|length=877bp
ATTTCCACATTCTATGGTTCTCGAAGGGGGAAGCATCCATGTGGATGGAG
AAGGTACATGCTTAACTACAGAGGAGTGCCTCTTGAACAAAAACAGGAAC
CCACATTTGAACAAAGGACAAATAGAGAACGAACTTAAGGCATATCTTGG
AGTCATGAAGATTATATGGTTGCCTCGTGGATTATTTGGTGATGATGATA
CTAATGGCCATATTGACAATATGTGCTGTTTTTCAAAGCCTGGTGTGGTG
TTACTGTCTTGGACTGATGATAAAACAGATCCTCAGTACGAACGATCTGT
GGAGGCGTTGACTATTCTCTCTGATGCTACTGATGCCAGAGGTCGGAAAT
TACAAATAATTAAACTTCATGTACCAGGGCCACTTTATATGACAGAAGAA
GAAGCTGCTGGACTTAATCAGGATGGTGAGGCTAAACCAAGACTTGCGGG
TACAAGACTTGCTGCTTCATATGTGAATTTCTACATTGCAAATGGAGGAA
TCATCGCACCACAGTTTGGGGACAAAAAGTGGGACGGTGAAGCTGTTCGT
GTCCTGTCTCAAGCCTTTCCTAAGTATGAAGTGGTAGGAATTGAAAGAGC
AAGGGAAATTGTTTTGGGAGGTGGGAAATATACATTGCATTACTCAACAA
CAACCAGCCATTCCAACAAATGCTGCGAAGCTAGACTGATTAGATACTGA
AATTATAACTGTNAANTCAGAGGCAGCAGCGTTGATCTCCAGATTGAGCA
TGTGTGTTTTTAAGAGGACATAATTTAAGCATTTGACAGTTAGTAGCTCT
GTGGGAATCCTGATGATTGATTGGCAAACACTGTCTTAAATAACATATGA
TAAAGCTTAAGCAAAATCAAAGGAAAA
back to top