DC900065

Overview
NameDC900065
Unique NameDC900065
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length646
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9752 contig Csv1_Contig9752:380..1025. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BURCM (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metE PE=3 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.189e-45
Identity = 93/148 (62.84%), Postives = 108/148 (72.97%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQL 444
            PLR+++   YL WAV +FRIT  GVQD TQIHTHMCYS FNDII SI DMDADVITIE SRSD +LL  F +  +Y   IGPGVYDIHSP IP+ + I   + K    +    LWVNPDCGLKTR++ EV PAL+NMVAAAK LR Q+
Sbjct:  617 PLRRAQWGEYLKWAVEAFRITANGVQDDTQIHTHMCYSEFNDIIASIADMDADVITIETSRSDMELLDAF-DSFRYPNEIGPGVYDIHSPNIPTQDHIVGLMKKAAERIPAERLWVNPDCGLKTRQWAEVIPALTNMVAAAKTLRNQV 763          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BURA4 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=metE PE=3 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.189e-45
Identity = 93/148 (62.84%), Postives = 108/148 (72.97%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQL 444
            PLR+++   YL WAV +FRIT  GVQD TQIHTHMCYS FNDII SI DMDADVITIE SRSD +LL  F +  +Y   IGPGVYDIHSP IP+ + I   + K    +    LWVNPDCGLKTR++ EV PAL+NMVAAAK LR Q+
Sbjct:  617 PLRRAQWGEYLKWAVEAFRITANGVQDDTQIHTHMCYSEFNDIIASIADMDADVITIETSRSDMELLDAF-DSFRYPNEIGPGVYDIHSPNIPTQDHIVGLMKKAAERIPAERLWVNPDCGLKTRQWAEVIPALTNMVAAAKTLRNQV 763          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BURVG (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=metE PE=3 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 2.649e-45
Identity = 91/148 (61.49%), Postives = 109/148 (73.65%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQL 444
            PLR+++   YL WA+ +FRI   GV+D TQIHTHMCYS FNDII SI +MDADVITIE SRSD +LL  F +G +Y   IGPGVYDIHSP IP+ E I   + K    +    LWVNPDCGLKTR++ EV PAL+NMVAAAK LR++L
Sbjct:  617 PLRRAQWPAYLKWAIDAFRIAANGVRDDTQIHTHMCYSEFNDIIASIAEMDADVITIETSRSDMELLDAF-DGFRYPNEIGPGVYDIHSPNIPTQEHIVGLMRKAAERIPAQRLWVNPDCGLKTRRWAEVLPALTNMVAAAKTLRSEL 763          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_CYTH3 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=metE PE=3 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.717e-44
Identity = 89/150 (59.33%), Postives = 110/150 (73.33%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLAS 450
            PLR+     YL+WAV  FRI+  GV+D TQIHTHMCYS FNDII +I  MDADVITIE SRS  +LL  F +   Y   IGPGVYDIHSPRIP+T+E+AD +NK + VL    +WVNPDCGLKTR++ E + AL NMVAAA+ +R ++ +
Sbjct:  625 PLRRENWETYLNWAVECFRISASGVKDETQIHTHMCYSEFNDIIKNIAAMDADVITIETSRSQMELLDAFVD-FNYPNEIGPGVYDIHSPRIPTTDEMADLLNKAMHVLPVRNIWVNPDCGLKTRRWPETEAALINMVAAAQKIRKEITT 773          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_PSYIN (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Psychromonas ingrahamii (strain 37) GN=metE PE=3 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 6.524e-44
Identity = 90/145 (62.07%), Postives = 103/145 (71.03%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PL +S+   YL+WA+ +FR+   GV D TQIHTHMCYS FNDII +I  MDADVITIE SRSD  LL VF E   Y  GIGPGVYDIHSP IP  E++   + K    +    LWVNPDCGLKTR++ EVKPAL NMVAAAK LR
Sbjct:  622 PLHRSQWQQYLNWAIAAFRLCANGVNDKTQIHTHMCYSEFNDIIAAIAQMDADVITIETSRSDMVLLDVF-EAFSYPNGIGPGVYDIHSPNIPDVEQMVSLMKKAALRIPAEQLWVNPDCGLKTRRWEEVKPALLNMVAAAKKLR 765          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_FLAJ1 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=metE PE=3 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 6.524e-44
Identity = 91/145 (62.76%), Postives = 105/145 (72.41%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PLRK E A YLDWAV +FRI+  GV D TQIH HMCYS FNDII +I DMDADVITIE SRS  +LL  F    KY   IGPGVYDIHSPR+PS++E+   + K  AV+  + LWVNPDCGLKTR + E K AL  MVAAA+ +R
Sbjct:  622 PLRKEEWAKYLDWAVKAFRISASGVNDDTQIHPHMCYSEFNDIIQNIADMDADVITIECSRSQMELLDAF-ANFKYPNEIGPGVYDIHSPRVPSSKEMVRLLEKASAVIPVDQLWVNPDCGLKTRHWNETKKALIEMVAAAQEMR 765          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BLOPB (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Blochmannia pennsylvanicus (strain BPEN) GN=metE PE=3 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 8.520e-44
Identity = 83/151 (54.97%), Postives = 113/151 (74.83%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLASA 453
            PL++S+   YL+WA++ FRIT   V+D TQIHTHMCYS F+DII++I+ +DADVI+IE +RSDEK+L   R  +K    IGPG+YDIHSP  P+  ++  RIN++L  +    LW+NPDCGLKTR + E+K +L+NMV+AAKLLR Q  S+
Sbjct:  614 PLKRSDQKQYLEWAINVFRITVSSVKDDTQIHTHMCYSEFSDIIYAILALDADVISIEAARSDEKILKSIRHVIKNLNEIGPGIYDIHSPNKPTQNDLIRRINQLLKYIPEQRLWINPDCGLKTRSWPEIKHSLNNMVSAAKLLRKQFYSS 764          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_HAHCH (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=metE PE=3 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.113e-43
Identity = 91/151 (60.26%), Postives = 104/151 (68.87%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLASA 453
            PLR+++   YL WAV SFRI   GV D TQIHTHMCYS FNDII +I  MDADVITIE SRSD +LL  F +  KY   IGPGVYDIHSP IPS   I   + K    +  + LWVNPDCGLKTR + EV+PAL NMV AAK LR  + +A
Sbjct:  612 PLRRAQWREYLQWAVSSFRIAANGVADETQIHTHMCYSEFNDIIEAIAGMDADVITIETSRSDMELLDAF-DNFKYPNEIGPGVYDIHSPNIPSETHIVQLMRKAAERIPAHRLWVNPDCGLKTRNWEEVRPALQNMVNAAKQLRADVVAA 761          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_MARAV (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Marinobacter aquaeolei (strain ATCC 700491 / DSM 11845 / VT8) GN=metE PE=3 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.453e-43
Identity = 89/146 (60.96%), Postives = 105/146 (71.92%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRT 438
            PLR+S+ A YL+WA++SFRI   GV D+TQIHTHMCYS FNDII +I  MDADVITIE SRSD +LL  FR   +Y   IGPGVYDIHSP IP  E I + +      +    LW+NPDCGLKTRK+ EV PAL  MVAAA+ LR+
Sbjct:  612 PLRQSDWATYLEWAINSFRIAANGVDDSTQIHTHMCYSEFNDIIEAIARMDADVITIETSRSDMELLDAFR-SFEYPNDIGPGVYDIHSPNIPDKEHIINLMTLAAERIPAERLWINPDCGLKTRKWEEVTPALETMVAAARELRS 756          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BURP8 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=metE PE=3 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 1.898e-43
Identity = 91/145 (62.76%), Postives = 101/145 (69.66%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PLR+S+   YL WAV SFRI   GVQD TQIHTHMCYS FNDII SI +MDADVITIE SRSD +LL  F +   Y   IGPGVYDIHSP IP    + D + K    +    LWVNPDCGLKTR + EV PAL NMVAAA+ LR
Sbjct:  617 PLRRSQWNEYLQWAVESFRIAANGVQDETQIHTHMCYSEFNDIIASIAEMDADVITIETSRSDMELLDAF-DDFHYPNQIGPGVYDIHSPNIPDQAHVVDLMKKAAERIPAERLWVNPDCGLKTRAWEEVIPALKNMVAAARTLR 760          
The following BLAST results are available for this feature:
BLAST of DC900065 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 274
Match NameE-valueIdentityDescription
METE_BURCM1.189e-4562.845-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BURA41.189e-4562.845-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BURVG2.649e-4561.495-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_CYTH31.717e-4459.335-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_PSYIN6.524e-4462.075-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_FLAJ16.524e-4462.765-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BLOPB8.520e-4454.975-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_HAHCH1.113e-4360.265-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_MARAV1.453e-4360.965-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BURP81.898e-4362.765-methyltetrahydropteroyltriglutamate--homocystein... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900065 VSS Citrus sinensis cDNA clone VS27Q70 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900065 ID=DC900065|Name=DC900065|organism=Citrus sinensis|type=EST|length=646bp
CCTCTTAGGAAATCTGAGCATGCTTTCTACTTGGACTGGGCAGTCCACTC
CTTCAGAATCACCAACTGTGGCGTCCAGGACACTACCCAGATCCACACCC
ACATGTGCTACTCCAACTTCAACGACATTATCCACTCAATTATCGACATG
GATGCTGATGTGATCACCATTGAGAACTCTCGTTCTGATGAGAAGCTCCT
GTCTGTCTTCCGTGAGGGAGTCAAGTATGGTGCTGGAATTGGCCCTGGTG
TGTATGACATCCACTCTCCAAGAATACCATCAACTGAAGAAATTGCTGAC
AGAATCAACAAGATGCTTGCTGTGCTAGAAACCAACATTTTGTGGGTTAA
CCCTGACTGTGGTCTTAAGACTCGCAAGTACACTGAGGTGAAGCCAGCCC
TCTCAAACATGGTCGCTGCTGCCAAGCTACTCCGCACCCAGCTTGCCAGT
GCCAAGTGAGTGGTTCTGGAGATTGGAGGGATACTTCCTGAGCCATTGAT
TTTTTTTTTTTTCACTTTAAACAAAGAAAGAAAATTCCTGTCTTATTACC
TATTCGAATAACTGTGGGTCGGGATGTGATGAAAATTTTCCGTATGCATA
TTATGCACTATTGAGCAATTGGCTTCTATTTTTCTTTGCTTGTAAA
back to top