DC900065

Overview
NameDC900065
Unique NameDC900065
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length646
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9752 contig Csv1_Contig9752:380..1025. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_SULAC (Probable methylcobalamin:homocysteine methyltransferase OS=Sulfolobus acidocaldarius GN=metE PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.956e-12
Identity = 40/138 (28.99%), Postives = 71/138 (51.45%), Query Frame = 1
Query:   31 LDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQL 444
            ++WA+ S   +  GV    ++  H+CY  ++ +   +  +  D I +     +   + +F+   K+   IG GV D+H+ +I S EE+A+ + K+L   +  ++WVNPDCGLK          L NMV    ++R +L
Sbjct:  191 VEWAIDSINESIKGVN--VKVVLHVCYGEYSYLEPHLDKLKVDQINLALKNYNYTPVKLFK---KWDREIGVGVIDVHNRKIESVEEVAEDLRKLLEYFKPEMVWVNPDCGLKLLPRKIALQKLINMVKGTLIVREEL 323          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_PYRKO (Probable methylcobalamin:homocysteine methyltransferase OS=Pyrococcus kodakaraensis GN=metE PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.268e-11
Identity = 37/116 (31.90%), Postives = 60/116 (51.72%), Query Frame = 1
Query:  100 HMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA 447
            H+CYSN+  +     D+      +E +  + + L   ++      G G  V D+H+PR+ S EE+A  I K++  +E   L++NPDCGLK          L NMV   +++R +LA
Sbjct:  210 HVCYSNYYLLADYFDDIKVSQFALEAANRNFRDLDYLKKLTHQELGFG--VVDVHNPRVESPEEVAKAIRKVMEYIEPERLYINPDCGLKLLDRRIAYQKLVNMVKGVEIVRRELA 323          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_SULIY (Probable methylcobalamin:homocysteine methyltransferase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=metE PE=3 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 9.508e-11
Identity = 41/140 (29.29%), Postives = 69/140 (49.29%), Query Frame = 1
Query:   31 LDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAG--IGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQL 444
            + W V +      GV    ++  H+CY  ++ +   + ++  D I       + K L + +   +YG    +G GV D+H+ RI ++EE+A+ I K+L       LW+NPDCGLK          L +MV   K++R +L
Sbjct:  190 VSWGVEAVNEAVKGVN--AKLVMHICYGEYSFVAPYLNELKVDQINFAFKIYNYKPLELLK---RYGFDKELGAGVIDVHNRRIETSEEVANDIRKILEYFTPEKLWINPDCGLKLLSRKIAYQKLVSMVEGTKVVREEL 324          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_AERPE (Probable methylcobalamin:homocysteine methyltransferase OS=Aeropyrum pernix GN=metE PE=3 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 9.508e-11
Identity = 38/116 (32.76%), Postives = 62/116 (53.45%), Query Frame = 1
Query:  100 HMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA--VLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQ 441
            H+CY     I+  I+D   D   +E   S+ +LL   +E   Y   IG GV D+HS ++ S  E+ + I++++   ++    ++V+PDCGLK       +  L NMV AA+L R +
Sbjct:  217 HICYGELERILPYILDYPVDQFDLEMKNSNFRLLPYLKE-YGYDKEIGYGVIDVHSFQVESVGEVKEAIDRLMKMDIVGPEKVYVDPDCGLKRLPRDVARAKLKNMVEAARLAREE 331          
The following BLAST results are available for this feature:
BLAST of DC900065 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 274
Match NameE-valueIdentityDescription
METE_SULAC2.956e-1228.99Probable methylcobalamin:homocysteine methyltransf... [more]
METE_PYRKO3.268e-1131.90Probable methylcobalamin:homocysteine methyltransf... [more]
METE_SULIY9.508e-1129.29Probable methylcobalamin:homocysteine methyltransf... [more]
METE_AERPE9.508e-1132.76Probable methylcobalamin:homocysteine methyltransf... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900065 VSS Citrus sinensis cDNA clone VS27Q70 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900065 ID=DC900065|Name=DC900065|organism=Citrus sinensis|type=EST|length=646bp
CCTCTTAGGAAATCTGAGCATGCTTTCTACTTGGACTGGGCAGTCCACTC
CTTCAGAATCACCAACTGTGGCGTCCAGGACACTACCCAGATCCACACCC
ACATGTGCTACTCCAACTTCAACGACATTATCCACTCAATTATCGACATG
GATGCTGATGTGATCACCATTGAGAACTCTCGTTCTGATGAGAAGCTCCT
GTCTGTCTTCCGTGAGGGAGTCAAGTATGGTGCTGGAATTGGCCCTGGTG
TGTATGACATCCACTCTCCAAGAATACCATCAACTGAAGAAATTGCTGAC
AGAATCAACAAGATGCTTGCTGTGCTAGAAACCAACATTTTGTGGGTTAA
CCCTGACTGTGGTCTTAAGACTCGCAAGTACACTGAGGTGAAGCCAGCCC
TCTCAAACATGGTCGCTGCTGCCAAGCTACTCCGCACCCAGCTTGCCAGT
GCCAAGTGAGTGGTTCTGGAGATTGGAGGGATACTTCCTGAGCCATTGAT
TTTTTTTTTTTTCACTTTAAACAAAGAAAGAAAATTCCTGTCTTATTACC
TATTCGAATAACTGTGGGTCGGGATGTGATGAAAATTTTCCGTATGCATA
TTATGCACTATTGAGCAATTGGCTTCTATTTTTCTTTGCTTGTAAA
back to top