DC900057

Overview
NameDC900057
Unique NameDC900057
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length931
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig328 contig Csv1_Contig328:359..1289. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSP2_HORVU (Cysteine proteinase EP-B 2 OS=Hordeum vulgare GN=EPB2 PE=1 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 3.738e-29
Identity = 62/94 (65.96%), Postives = 69/94 (73.40%), Query Frame = 1
Query:    7 LQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYG-TEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            L +AVANQPVSVA+E  G AF  Y  G+FTG CGT LDHGV  VGYG  E G  YW VKNSWG SWGE GYIR+E++ +G   G CGIAMEASY
Sbjct:  259 LARAVANQPVSVAVEASGKAFMFYSEGVFTGECGTELDHGVAVVGYGVAEDGKAYWTVKNSWGPSWGEQGYIRVEKD-SGASGGLCGIAMEASY 351          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSP1_HORVU (Cysteine proteinase EP-B 1 OS=Hordeum vulgare GN=EPB1 PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 6.376e-29
Identity = 62/94 (65.96%), Postives = 69/94 (73.40%), Query Frame = 1
Query:    7 LQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYG-TEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            L +AVANQPVSVA+E  G AF  Y  G+FTG CGT LDHGV  VGYG  E G  YW VKNSWG SWGE GYIR+E++ +G   G CGIAMEASY
Sbjct:  259 LARAVANQPVSVAVEASGKAFMFYSEGVFTGDCGTELDHGVAVVGYGVAEDGKAYWTVKNSWGPSWGEQGYIRVEKD-SGASGGLCGIAMEASY 351          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CPR4_ARATH (Probable cysteine proteinase At4g11320 OS=Arabidopsis thaliana GN=At4g11320 PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 6.376e-29
Identity = 59/94 (62.77%), Postives = 70/94 (74.47%), Query Frame = 1
Query:    4 ALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            AL KAVA+QPV+  ++     FQLYESG+F G CGT+L+HGV  VGYGTE G DYWIVKNS G +WGE GY++M RN+A    G CGIAM ASY
Sbjct:  265 ALMKAVAHQPVTAVVDSSSREFQLYESGVFDGTCGTNLNHGVVVVGYGTENGRDYWIVKNSRGDTWGEAGYMKMARNIANP-RGLCGIAMRASY 357          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CPGP2_ZINOF (Zingipain-2 OS=Zingiber officinale PE=1 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 6.376e-29
Identity = 60/95 (63.16%), Postives = 69/95 (72.63%), Query Frame = 1
Query:    1 KALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            ++LQKAVANQPVSV ++  G  FQLY SGIFTG C  S +H +T VGYGTE   D+WIVKNSWG +WGE GYIR ERN+     GKCGI   ASY
Sbjct:  121 QSLQKAVANQPVSVTMDAAGRDFQLYRSGIFTGSCNISANHALTVVGYGTENDKDFWIVKNSWGKNWGESGYIRAERNIENP-DGKCGITRFASY 214          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSEP_VIGMU (Vignain OS=Vigna mungo PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.420e-28
Identity = 62/95 (65.26%), Postives = 70/95 (73.68%), Query Frame = 1
Query:    4 ALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTE-XGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            AL KAVANQPVSVAI+ GG  FQ Y  G+FTG C T L+HGV  VGYGT   G +YWIV+NSWG  WGE GYIRM+RN++    G CGIAM ASY
Sbjct:  249 ALLKAVANQPVSVAIDAGGSDFQFYSEGVFTGDCNTDLNHGVAIVGYGTTVDGTNYWIVRNSWGPEWGEQGYIRMQRNIS-KKEGLCGIAMMASY 342          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CPR3_ARATH (Probable cysteine proteinase At4g11310 OS=Arabidopsis thaliana GN=At4g11310 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.420e-28
Identity = 59/94 (62.77%), Postives = 70/94 (74.47%), Query Frame = 1
Query:    4 ALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            AL KAVA+QPV+  I+     FQLYESG+F G CGT+L+HGV  VGYGTE G DYW+VKNS G +WGE GY++M RN+A    G CGIAM ASY
Sbjct:  258 ALMKAVAHQPVTAVIDSSSREFQLYESGVFDGSCGTNLNHGVVVVGYGTENGRDYWLVKNSRGITWGEAGYMKMARNIANP-RGLCGIAMRASY 350          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: ACTN_ACTDE (Actinidain OS=Actinidia deliciosa PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.420e-28
Identity = 61/94 (64.89%), Postives = 70/94 (74.47%), Query Frame = 1
Query:    4 ALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            ALQ AV  QPVSVA++  G AF+ Y SGIFTG CGT++DH VT VGYGTE G DYWIVKNSW ++WGE GY+R+ RNV G   G CGIA   SY
Sbjct:  249 ALQTAVTYQPVSVALDAAGDAFKHYSSGIFTGPCGTAIDHAVTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGG--AGTCGIATMPSY 340          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: ACTN_ACTCH (Actinidain OS=Actinidia chinensis PE=1 SV=4)

HSP 1 Score: 127.102 bits (318), Expect = 1.420e-28
Identity = 61/94 (64.89%), Postives = 70/94 (74.47%), Query Frame = 1
Query:    4 ALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            ALQ AV  QPVSVA++  G AF+ Y SGIFTG CGT++DH VT VGYGTE G DYWIVKNSW ++WGE GY+R+ RNV G   G CGIA   SY
Sbjct:  249 ALQTAVTYQPVSVALDAAGDAFKQYSSGIFTGPCGTAVDHAVTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGG--AGTCGIATMPSY 340          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: ERVB_TABDI (Ervatamin-B OS=Tabernaemontana divaricata PE=1 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 3.165e-28
Identity = 60/94 (63.83%), Postives = 69/94 (73.40%), Query Frame = 1
Query:    4 ALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            ALQ AVA+QPVSV +E  G  FQ Y SGIFTG CGT+ +HGV  VGYGT+ G +YWIV+NSWG +WG  GYI MERNVA +  G CGIA   SY
Sbjct:  119 ALQSAVASQPVSVTVEAAGAPFQHYSSGIFTGPCGTAQNHGVVIVGYGTQSGKNYWIVRNSWGQNWGNQGYIWMERNVASS-AGLCGIAQLPSY 211          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSEP_PHAVU (Vignain OS=Phaseolus vulgaris PE=2 SV=2)

HSP 1 Score: 124.79 bits (312), Expect = 7.050e-28
Identity = 61/95 (64.21%), Postives = 69/95 (72.63%), Query Frame = 1
Query:    4 ALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTE-XGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            AL KAVANQPVSVAI+ GG  FQ Y  G+FTG C T L+HGV  VGYGT   G +YWIV+NSWG  WGE GYIRM+RN++    G CGIAM  SY
Sbjct:  249 ALLKAVANQPVSVAIDAGGSDFQFYSEGVFTGDCSTDLNHGVAIVGYGTTVDGTNYWIVRNSWGPEWGEHGYIRMQRNIS-KKEGLCGIAMLPSY 342          
The following BLAST results are available for this feature:
BLAST of DC900057 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 106
Match NameE-valueIdentityDescription
CYSP2_HORVU3.738e-2965.96Cysteine proteinase EP-B 2 OS=Hordeum vulgare GN=E... [more]
CYSP1_HORVU6.376e-2965.96Cysteine proteinase EP-B 1 OS=Hordeum vulgare GN=E... [more]
CPR4_ARATH6.376e-2962.77Probable cysteine proteinase At4g11320 OS=Arabidop... [more]
CPGP2_ZINOF6.376e-2963.16Zingipain-2 OS=Zingiber officinale PE=1 SV=1[more]
CYSEP_VIGMU1.420e-2865.26Vignain OS=Vigna mungo PE=1 SV=1[more]
CPR3_ARATH1.420e-2862.77Probable cysteine proteinase At4g11310 OS=Arabidop... [more]
ACTN_ACTDE1.420e-2864.89Actinidain OS=Actinidia deliciosa PE=1 SV=1[more]
ACTN_ACTCH1.420e-2864.89Actinidain OS=Actinidia chinensis PE=1 SV=4[more]
ERVB_TABDI3.165e-2863.83Ervatamin-B OS=Tabernaemontana divaricata PE=1 SV=... [more]
CYSEP_PHAVU7.050e-2864.21Vignain OS=Phaseolus vulgaris PE=2 SV=2[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900057 VSS Citrus sinensis cDNA clone VS27Q65 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900057 ID=DC900057|Name=DC900057|organism=Citrus sinensis|type=EST|length=931bp
AAAGCTTTGCAAAAGGCAGTTGCAAATCAACCCGTGAGTGTTGCCATTGA
AGGAGGTGGCATGGCATTCCAGTTATATGAATCGGGTATATTTACGGGAA
GATGTGGGACATCTCTGGACCATGGTGTTACTGCTGTTGGATATGGCACA
GAAANTGGAGCTGATTACTGGATTGTGAAGAATTCATGGGGCAGTAGCTG
GGGAGAGGGTGGCTATATTAGGATGGAGCGTAACGTGGCTGGCACTCTCA
CGGGCAAGTGTGGAATTGCCATGGAGGCCTCATATCCCATAAAGAAAGGC
CAAAATCCTCCCAACCCCGGACCGTCTCCTCCATCTCCAACAAAGCCTCC
TGCTGTGTGTGACAATTATTACTCTTGCCCTGAGAGCAACACTTGCTGCT
GTGTCTTTGAGTATGGTAACTCTTGCTTTGCATGGGGATGCTGCCCGCTT
GAGGCTGCCACCTGCTGTGATGACCACTATAGCTGCTGCCCACATGACTA
TCCCATCTGTAATGTTCGTGCTGGGACCTGCTTGATGAGCAAGGACAACC
CATTGGGAGTGAGGGCATTGCGACGCACCCCTGCTAAACCTTACTGGGCT
CATGGAAATCAAGGTGGAAGTAGCAGTGCTTAATTATAGTTGGCACTGTA
AGAGCAGTGGAAGGCCGAAGGGAGGATGAAGATATTCGTGCTTGTGAATG
AGTTTCTCCCCGGCCTTAGTTCATTTTACTGCATTTCATTTCAAACGTTA
ATGTANCGGCAGGTGGATGGTCTGTTAAATATTTATTCGGACGTTGGTTT
TGTATATAGCGTTGTAAGTTATCTATCTGCGTTGAATCCGAACAATGCAC
AAACAAATTGTTGTTATCTATTTCCAATGTCCTCCACCAAATCCCTGGCA
TCATTCAGCGGAGGCTTTTATGAATTGATAT
back to top