DC900057

Overview
NameDC900057
Unique NameDC900057
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length931
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig328 contig Csv1_Contig328:359..1289. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: PAPA1_CARPA (Papain OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 2.429e-20
Identity = 48/94 (51.06%), Postives = 60/94 (63.83%), Query Frame = 1
Query:    4 ALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            AL  ++ANQPVSV +E  G  FQLY  GIF G CG  +DH V AVGY    G +Y ++KNSWG+ WGE GYIR++R   G   G CG+   + Y
Sbjct:  253 ALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGY----GPNYILIKNSWGTGWGENGYIRIKRG-TGNSYGVCGLYTSSFY 341          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: ERVC_TABDI (Ervatamin-C OS=Tabernaemontana divaricata PE=1 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 2.429e-20
Identity = 54/89 (60.67%), Postives = 62/89 (69.66%), Query Frame = 1
Query:    4 ALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIA 270
            AL++AVA QP +VAI+     FQ Y SGIF+G CGT L+HGVT VGY     A+YWIV+NSWG  WGE GYIRM R V G   G CGIA
Sbjct:  118 ALKQAVAVQPSTVAIDASSAQFQQYSSGIFSGPCGTKLNHGVTIVGY----QANYWIVRNSWGRYWGEKGYIRMLR-VGG--CGLCGIA 199          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: MEX1_JACME (Mexicain OS=Jacaratia mexicana PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 2.056e-19
Identity = 46/88 (52.27%), Postives = 60/88 (68.18%), Query Frame = 1
Query:    4 ALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGI 267
            +L +A+ANQPVSV  +  G  FQ Y+ GI+ G CGT+ DH VTAVGY    G  Y ++KNSWG +WGE GYIR++R  +G   G CG+
Sbjct:  120 SLIQAIANQPVSVVTDSRGRGFQFYKGGIYEGPCGTNTDHAVTAVGY----GKTYLLLKNSWGPNWGEKGYIRIKR-ASGRSKGTCGV 202          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATL_SARPE (Cathepsin L OS=Sarcophaga peregrina PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.507e-19
Identity = 52/97 (53.61%), Postives = 65/97 (67.01%), Query Frame = 1
Query:    7 LQKAVANQ-PVSVAIEGGGMAFQLYESGIFTG-RCGT-SLDHGVTAVGYGT-EXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            ++KAVA   PVSVAI+    +FQLY  G++    C   +LDHGV  VGYGT E G DYW+VKNSWG++WGE GYI+M RN       +CGIA  +SY
Sbjct:  244 MKKAVATMGPVSVAIDASHESFQLYSEGVYNEPECDEQNLDHGVLVVGYGTDESGMDYWLVKNSWGTTWGEQGYIKMARN----QNNQCGIATASSY 336          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATL1_CHICK (Cathepsin L1 (Fragments) OS=Gallus gallus GN=CTSL1 PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 5.982e-19
Identity = 53/98 (54.08%), Postives = 63/98 (64.29%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGIF-TGRCGTS-LDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            +AL KAVA+  PVSVAI+ G  +FQ Y+SGI+    C +  LDHGV  VGYG E G  YWIVKNSWG  WG+ GYI M ++        CGIA  ASY
Sbjct:  122 RALMKAVASVGPVSVAIDAGHSSFQFYQSGIYYEPDCSSEDLDHGVLVVGYGFEGGKKYWIVKNSWGEKWGDKGYIYMAKD----RKNHCGIATAASY 215          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSP2_HOMAM (Digestive cysteine proteinase 2 OS=Homarus americanus GN=LCP2 PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.740e-18
Identity = 49/96 (51.04%), Postives = 62/96 (64.58%), Query Frame = 1
Query:    7 LQKAVAN-QPVSVAIEGGGMAFQLYESGIF-TGRCGTS-LDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            LQ+AV +  P+SV I+    +FQ Y SG++    C  S LDH V AVGYG+E G D+W+VKNSW +SWG+ GYI+M RN        CGIA  ASY
Sbjct:  229 LQQAVRDIGPISVTIDAAHSSFQFYSSGVYYEPSCSPSYLDHAVLAVGYGSEGGQDFWLVKNSWATSWGDAGYIKMSRN----RNNNCGIATVASY 320          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSP3_DICDI (Cysteine proteinase 3 OS=Dictyostelium discoideum GN=cprC PE=3 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 3.877e-18
Identity = 50/95 (52.63%), Postives = 60/95 (63.16%), Query Frame = 1
Query:    7 LQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTS--LDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            LQ A+   PVSVAI+    +FQLY +G++     +S  LDHGV AVG GT+ G DY+IVKNSWG SWG  GYI M RN        CGI+  ASY
Sbjct:  244 LQNALLLNPVSVAIDASHNSFQLYTAGVYYEPACSSEDLDHGVLAVGMGTDNGEDYYIVKNSWGPSWGLNGYIHMARN----KDNNCGISTMASY 334          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSP1_HOMAM (Digestive cysteine proteinase 1 OS=Homarus americanus GN=LCP1 PE=1 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 5.064e-18
Identity = 45/87 (51.72%), Postives = 58/87 (66.67%), Query Frame = 1
Query:   31 PVSVAIEGGGMAFQLYESGIF-TGRCGTS-LDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            P+SVAI+    +FQ Y +G++    C +S LDH V AVGYG+E G D+W+VKNSW +SWGE GYI+M RN        CGIA +A Y
Sbjct:  237 PISVAIDASHRSFQSYYTGVYYEPSCSSSQLDHAVLAVGYGSEGGQDFWLVKNSWATSWGESGYIKMARN----RNNNCGIATDACY 319          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CPR2_ARATH (Probable cysteine proteinase At3g43960 OS=Arabidopsis thaliana GN=At3g43960 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 6.614e-18
Identity = 46/96 (47.92%), Postives = 61/96 (63.54%), Query Frame = 1
Query:    4 ALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSL-DHGVTAVGYGTEXG-ADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            +L+KAVA QP+SV I    M+   Y+SG++ G C     DH V  VGYGT     DYW+++NSWG  WGEGGY+R++RN     TGKC +A+   Y
Sbjct:  252 SLKKAVAYQPISVMISAANMSD--YKSGVYKGACSNLWGDHNVLIVGYGTSSDEGDYWLIRNSWGPEWGEGGYLRLQRNFHEP-TGKCAVAVAPVY 344          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATS_CANFA (Cathepsin S OS=Canis familiaris GN=CTSS PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 8.638e-18
Identity = 49/96 (51.04%), Postives = 63/96 (65.62%), Query Frame = 1
Query:    4 ALQKAVANQ-PVSVAIEGGGMAFQLYESGIF-TGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            AL++AVAN+ PVSVAI+    +F LY SG++    C  +++HGV  VGYG   G DYW+VKNSWG ++G+ GYIRM RN        CGIA   SY
Sbjct:  237 ALKEAVANKGPVSVAIDASHYSFFLYRSGVYYEPSCTQNVNHGVLVVGYGNLNGKDYWLVKNSWGLNFGDQGYIRMARNSG----NHCGIASYPSY 328          
The following BLAST results are available for this feature:
BLAST of DC900057 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 106
Match NameE-valueIdentityDescription
PAPA1_CARPA2.429e-2051.06Papain OS=Carica papaya PE=1 SV=1[more]
ERVC_TABDI2.429e-2060.67Ervatamin-C OS=Tabernaemontana divaricata PE=1 SV=... [more]
MEX1_JACME2.056e-1952.27Mexicain OS=Jacaratia mexicana PE=1 SV=1[more]
CATL_SARPE3.507e-1953.61Cathepsin L OS=Sarcophaga peregrina PE=1 SV=1[more]
CATL1_CHICK5.982e-1954.08Cathepsin L1 (Fragments) OS=Gallus gallus GN=CTSL1... [more]
CYSP2_HOMAM1.740e-1851.04Digestive cysteine proteinase 2 OS=Homarus america... [more]
CYSP3_DICDI3.877e-1852.63Cysteine proteinase 3 OS=Dictyostelium discoideum ... [more]
CYSP1_HOMAM5.064e-1851.72Digestive cysteine proteinase 1 OS=Homarus america... [more]
CPR2_ARATH6.614e-1847.92Probable cysteine proteinase At3g43960 OS=Arabidop... [more]
CATS_CANFA8.638e-1851.04Cathepsin S OS=Canis familiaris GN=CTSS PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900057 VSS Citrus sinensis cDNA clone VS27Q65 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900057 ID=DC900057|Name=DC900057|organism=Citrus sinensis|type=EST|length=931bp
AAAGCTTTGCAAAAGGCAGTTGCAAATCAACCCGTGAGTGTTGCCATTGA
AGGAGGTGGCATGGCATTCCAGTTATATGAATCGGGTATATTTACGGGAA
GATGTGGGACATCTCTGGACCATGGTGTTACTGCTGTTGGATATGGCACA
GAAANTGGAGCTGATTACTGGATTGTGAAGAATTCATGGGGCAGTAGCTG
GGGAGAGGGTGGCTATATTAGGATGGAGCGTAACGTGGCTGGCACTCTCA
CGGGCAAGTGTGGAATTGCCATGGAGGCCTCATATCCCATAAAGAAAGGC
CAAAATCCTCCCAACCCCGGACCGTCTCCTCCATCTCCAACAAAGCCTCC
TGCTGTGTGTGACAATTATTACTCTTGCCCTGAGAGCAACACTTGCTGCT
GTGTCTTTGAGTATGGTAACTCTTGCTTTGCATGGGGATGCTGCCCGCTT
GAGGCTGCCACCTGCTGTGATGACCACTATAGCTGCTGCCCACATGACTA
TCCCATCTGTAATGTTCGTGCTGGGACCTGCTTGATGAGCAAGGACAACC
CATTGGGAGTGAGGGCATTGCGACGCACCCCTGCTAAACCTTACTGGGCT
CATGGAAATCAAGGTGGAAGTAGCAGTGCTTAATTATAGTTGGCACTGTA
AGAGCAGTGGAAGGCCGAAGGGAGGATGAAGATATTCGTGCTTGTGAATG
AGTTTCTCCCCGGCCTTAGTTCATTTTACTGCATTTCATTTCAAACGTTA
ATGTANCGGCAGGTGGATGGTCTGTTAAATATTTATTCGGACGTTGGTTT
TGTATATAGCGTTGTAAGTTATCTATCTGCGTTGAATCCGAACAATGCAC
AAACAAATTGTTGTTATCTATTTCCAATGTCCTCCACCAAATCCCTGGCA
TCATTCAGCGGAGGCTTTTATGAATTGATAT
back to top