DC900057

Overview
NameDC900057
Unique NameDC900057
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length931
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig328 contig Csv1_Contig328:359..1289. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CFAD_DICDI (Counting factor associated protein D OS=Dictyostelium discoideum GN=cfaD PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 9.883e-14
Identity = 41/99 (41.41%), Postives = 59/99 (59.60%), Query Frame = 1
Query:    4 ALQKAVANQ-PVSVAIEGGGMAFQLYESGIFTGRCGTS----LDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            ALQ A+A   PV++AI+     F+ Y SG++      +    LDH V A+GYGT  G DY++VKNSW ++WG  GY+ M RN        CG++ +A+Y
Sbjct:  431 ALQNAIATTGPVAIAIDASVDDFRYYMSGVYNNPACKNGLDDLDHEVLAIGYGTYQGQDYFLVKNSWSTNWGMDGYVYMARND----NNLCGVSSQATY 525          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: TEST2_MOUSE (Testin-2 OS=Mus musculus PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.202e-13
Identity = 46/102 (45.10%), Postives = 59/102 (57.84%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGIF-TGRCG-TSLDHGVTAVGYGTEX----GADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            +AL KAVA   P+SVA++    +FQ Y+SGI+   +C    L+H V  VGYG E     G  YW+VKNSWG  WG  GYI+    +A      CGIA  A+Y
Sbjct:  233 EALMKAVAKVGPISVAVDASHDSFQFYDSGIYYEPQCKRVHLNHAVLVVGYGFEGEESDGNSYWLVKNSWGEEWGMKGYIK----IAKDWNNHCGIATLATY 330          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATLL_PHACE (Cathepsin L-like proteinase OS=Phaedon cochleariae PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.756e-13
Identity = 42/97 (43.30%), Postives = 56/97 (57.73%), Query Frame = 1
Query:    4 ALQKAVAN-QPVSVAIEGGGMAFQLYESGIF--TGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            +L++AV    P+S  + G  M  + Y  GIF  +   G +L HGV  VGYG E G  YWI+KN+WG+ WGE GYIR+ R+        CG+   ASY
Sbjct:  230 SLKEAVGTIGPISAVVFGKPM--KSYGGGIFDDSSCLGDNLHHGVNVVGYGIENGQKYWIIKNTWGADWGESGYIRLIRDT----DHSCGVEKMASY 320          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CPP1_ENTHI (Cysteine proteinase 1 OS=Entamoeba histolytica GN=CPP1 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 4.905e-13
Identity = 40/88 (45.45%), Postives = 54/88 (61.36%), Query Frame = 1
Query:    7 LQKAVANQPVSVAIEGGGMAFQLYESGIFTG-RCGTS---LDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRM--ERNVAGTLT 252
            L+ A++   V V+I+   + FQLY+SG +T  +C  +   L+H V AVGYG   G + WIV+NSWG+ WGE GYI M  E N  G  T
Sbjct:  217 LKAAISQGLVDVSIDASSVQFQLYKSGAYTDTQCKNNYFALNHEVCAVGYGVVDGKECWIVRNSWGTGWGEKGYINMVIEGNTCGVAT 304          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: ALEUL_ARATH (Thiol protease aleurain-like OS=Arabidopsis thaliana GN=At3g45310 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 4.905e-13
Identity = 39/90 (43.33%), Postives = 52/90 (57.78%), Query Frame = 1
Query:   28 QPVSVAIEGGGMAFQLYESGIFTGR-CGTS---LDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            +PVSVA E     F+ Y+ G+FT   CG +   ++H V AVGYG E    YW++KNSWG  WG+ GY +ME          CG+A  +SY
Sbjct:  271 RPVSVAFEVVH-EFRFYKKGVFTSNTCGNTPMDVNHAVLAVGYGVEDDVPYWLIKNSWGGEWGDNGYFKMEMG-----KNMCGVATCSSY 354          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: ACP1_ENTHI (Cysteine proteinase ACP1 OS=Entamoeba histolytica GN=ACP1 PE=1 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 8.366e-13
Identity = 38/97 (39.18%), Postives = 58/97 (59.79%), Query Frame = 1
Query:    7 LQKAVA-NQPVSVAIEGGGMAFQLYESGIFTG--RCGTSL-DHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            LQ  +A N PV+V ++    +FQLY+ G      +C + + +H VTAVGYG+     YWI++NSWG+SWG+ GY  + R+        CGI  +++Y
Sbjct:  209 LQTIIAENGPVAVGMDASRPSFQLYKKGTIYSDTKCRSRMMNHCVTAVGYGSNSNGKYWIIRNSWGTSWGDAGYFLLARD----SNNMCGIGRDSNY 301          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSP_PLAVN (Cysteine proteinase OS=Plasmodium vinckei PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.093e-12
Identity = 43/116 (37.07%), Postives = 55/116 (47.41%), Query Frame = 1
Query:   31 PVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEX-------------------------GAD------YWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            PV++A+ G    F LY  G+F G C   L+H V  VGYG                            G D      YWIV+NSWG +WGEGGYIR++RN AG   G CG+  +  +
Sbjct:  390 PVTIAV-GASEDFVLYSGGVFDGECNPELNHSVLLVGYGQVKKSLAFEDSHSNVDSNLIKKYKENIKGDDDDDIIYYWIVRNSWGPNWGEGGYIRIKRNKAGD-DGFCGVGSDVFF 503          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATH_MOUSE (Cathepsin H OS=Mus musculus GN=Ctsh PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.427e-12
Identity = 46/99 (46.46%), Postives = 58/99 (58.59%), Query Frame = 1
Query:    4 ALQKAVA-NQPVSVAIEGGGMAFQLYESGIFTGR-CGTSLD---HGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            A+ +AVA   PVS A E     F +Y+SG+++ + C  + D   H V AVGYG + G  YWIVKNSWGS WGE GY  +ER         CG+A  ASY
Sbjct:  236 AMVEAVALYNPVSFAFEVTE-DFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERG-----KNMCGLAACASY 328          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CPP2_ENTHI (Cysteine proteinase 2 OS=Entamoeba histolytica GN=CPP2 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.434e-12
Identity = 39/88 (44.32%), Postives = 53/88 (60.23%), Query Frame = 1
Query:    7 LQKAVANQPVSVAIEGGGMAFQLYESGIFTG-RCGTS---LDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRM--ERNVAGTLT 252
            L+ A++   V V+I+     FQLY+SG +T  +C  +   L+H V AVGYG   G + WIV+NSWG+ WG+ GYI M  E N  G  T
Sbjct:  217 LKAALSQGLVDVSIDASSAKFQLYKSGAYTDTKCKNNYFALNHEVCAVGYGVVDGKECWIVRNSWGTGWGDKGYINMVIEGNTCGVAT 304          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATH_RAT (Cathepsin H OS=Rattus norvegicus GN=Ctsh PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 3.179e-12
Identity = 43/99 (43.43%), Postives = 57/99 (57.58%), Query Frame = 1
Query:    4 ALQKAVA-NQPVSVAIEGGGMAFQLYESGIFTG----RCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            A+ +AVA   PVS A E     F +Y+SG+++     +    ++H V AVGYG + G  YWIVKNSWGS+WG  GY  +ER         CG+A  ASY
Sbjct:  236 AMVEAVALYNPVSFAFEVTE-DFMMYKSGVYSSNSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSNWGNNGYFLIERG-----KNMCGLAACASY 328          
The following BLAST results are available for this feature:
BLAST of DC900057 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 106
Match NameE-valueIdentityDescription
CFAD_DICDI9.883e-1441.41Counting factor associated protein D OS=Dictyostel... [more]
TEST2_MOUSE2.202e-1345.10Testin-2 OS=Mus musculus PE=2 SV=1[more]
CATLL_PHACE3.756e-1343.30Cathepsin L-like proteinase OS=Phaedon cochleariae... [more]
CPP1_ENTHI4.905e-1345.45Cysteine proteinase 1 OS=Entamoeba histolytica GN=... [more]
ALEUL_ARATH4.905e-1343.33Thiol protease aleurain-like OS=Arabidopsis thalia... [more]
ACP1_ENTHI8.366e-1339.18Cysteine proteinase ACP1 OS=Entamoeba histolytica ... [more]
CYSP_PLAVN1.093e-1237.07Cysteine proteinase OS=Plasmodium vinckei PE=3 SV=... [more]
CATH_MOUSE1.427e-1246.46Cathepsin H OS=Mus musculus GN=Ctsh PE=2 SV=1[more]
CPP2_ENTHI2.434e-1244.32Cysteine proteinase 2 OS=Entamoeba histolytica GN=... [more]
CATH_RAT3.179e-1243.43Cathepsin H OS=Rattus norvegicus GN=Ctsh PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900057 VSS Citrus sinensis cDNA clone VS27Q65 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900057 ID=DC900057|Name=DC900057|organism=Citrus sinensis|type=EST|length=931bp
AAAGCTTTGCAAAAGGCAGTTGCAAATCAACCCGTGAGTGTTGCCATTGA
AGGAGGTGGCATGGCATTCCAGTTATATGAATCGGGTATATTTACGGGAA
GATGTGGGACATCTCTGGACCATGGTGTTACTGCTGTTGGATATGGCACA
GAAANTGGAGCTGATTACTGGATTGTGAAGAATTCATGGGGCAGTAGCTG
GGGAGAGGGTGGCTATATTAGGATGGAGCGTAACGTGGCTGGCACTCTCA
CGGGCAAGTGTGGAATTGCCATGGAGGCCTCATATCCCATAAAGAAAGGC
CAAAATCCTCCCAACCCCGGACCGTCTCCTCCATCTCCAACAAAGCCTCC
TGCTGTGTGTGACAATTATTACTCTTGCCCTGAGAGCAACACTTGCTGCT
GTGTCTTTGAGTATGGTAACTCTTGCTTTGCATGGGGATGCTGCCCGCTT
GAGGCTGCCACCTGCTGTGATGACCACTATAGCTGCTGCCCACATGACTA
TCCCATCTGTAATGTTCGTGCTGGGACCTGCTTGATGAGCAAGGACAACC
CATTGGGAGTGAGGGCATTGCGACGCACCCCTGCTAAACCTTACTGGGCT
CATGGAAATCAAGGTGGAAGTAGCAGTGCTTAATTATAGTTGGCACTGTA
AGAGCAGTGGAAGGCCGAAGGGAGGATGAAGATATTCGTGCTTGTGAATG
AGTTTCTCCCCGGCCTTAGTTCATTTTACTGCATTTCATTTCAAACGTTA
ATGTANCGGCAGGTGGATGGTCTGTTAAATATTTATTCGGACGTTGGTTT
TGTATATAGCGTTGTAAGTTATCTATCTGCGTTGAATCCGAACAATGCAC
AAACAAATTGTTGTTATCTATTTCCAATGTCCTCCACCAAATCCCTGGCA
TCATTCAGCGGAGGCTTTTATGAATTGATAT
back to top