DC900049

Overview
NameDC900049
Unique NameDC900049
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length622
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4158 contig Csv1_Contig4158:637..1258. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA5_RAT (Annexin A5 OS=Rattus norvegicus GN=Anxa5 PE=1 SV=3)

HSP 1 Score: 76.2554 bits (186), Expect = 1.430e-13
Identity = 42/132 (31.82%), Postives = 72/132 (54.55%), Query Frame = -3
Query:  210 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 605
            +++E  I IL TRS + +    ++Y  + G  I++ ++ +      +LL A V+ +     Y  + L  A+   GTD+  L RV+ +R+E+DL  I+ E+++  +  L   +  DTSGDY+K LL L G  D
Sbjct:  187 TDEEKFITILGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLENLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVIVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGGED 318          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA7_HUMAN (Annexin A7 OS=Homo sapiens GN=ANXA7 PE=1 SV=3)

HSP 1 Score: 75.8702 bits (185), Expect = 1.868e-13
Identity = 41/121 (33.88%), Postives = 64/121 (52.89%), Query Frame = -3
Query:  219 ILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 581
            ILATRS  Q+ AT+  Y  +   D+   +  +        L+  +QC +    +F + L  A+   GTD+  L R+V TR+E+DL  IK  + +     L   +  DTSGDY ++LLA++G
Sbjct:  367 ILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYAMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRLLLAIVG 487          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA1_PONAB (Annexin A1 OS=Pongo abelii GN=ANXA1 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.868e-13
Identity = 41/121 (33.88%), Postives = 68/121 (56.20%), Query Frame = -3
Query:  219 ILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 581
            IL TRS  Q+     +Y     +D+++ L+ + K +    L A V+C      +F + L  A+   GT   AL R++ +R+E+D+  IK  YQ+   + L +A++ +T GDYEK+L+AL G
Sbjct:  224 ILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEKLHQAMKGVGTRHKALIRIMVSRSEIDMNDIKAFYQKMYGISLCQAILDETKGDYEKILVALCG 344          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA1_PANTR (Annexin A1 OS=Pan troglodytes GN=ANXA1 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.868e-13
Identity = 41/121 (33.88%), Postives = 68/121 (56.20%), Query Frame = -3
Query:  219 ILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 581
            IL TRS  Q+     +Y     +D+++ L+ + K +    L A V+C      +F + L  A+   GT   AL R++ +R+E+D+  IK  YQ+   + L +A++ +T GDYEK+L+AL G
Sbjct:  224 ILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEKLHQAMKGVGTRHKALIRIMVSRSEIDMNDIKAFYQKMYGISLCQAILDETKGDYEKILVALCG 344          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA1_HUMAN (Annexin A1 OS=Homo sapiens GN=ANXA1 PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 1.868e-13
Identity = 41/121 (33.88%), Postives = 68/121 (56.20%), Query Frame = -3
Query:  219 ILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 581
            IL TRS  Q+     +Y     +D+++ L+ + K +    L A V+C      +F + L  A+   GT   AL R++ +R+E+D+  IK  YQ+   + L +A++ +T GDYEK+L+AL G
Sbjct:  224 ILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEKLHQAMKGVGTRHKALIRIMVSRSEIDMNDIKAFYQKMYGISLCQAILDETKGDYEKILVALCG 344          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA1_RAT (Annexin A1 OS=Rattus norvegicus GN=Anxa1 PE=1 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 2.440e-13
Identity = 39/121 (32.23%), Postives = 67/121 (55.37%), Query Frame = -3
Query:  219 ILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 581
            IL TRS   +      Y+    +D+++ L+ + K +    L   V+C      +F + L  A+   GT    L R++ +R+E+D+  IK  YQ++  +PL +A++ +T GDYEK+L+AL G
Sbjct:  224 ILTTRSYPHLRKVFQNYRKYSQHDMNKALDLELKGDIEKCLTTIVKCATSTPAFFAEKLYEAMKGAGTRHKTLIRIMVSRSEIDMNEIKVFYQKKYGIPLCQAILDETKGDYEKILVALCG 344          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA7_XENLA (Annexin A7 OS=Xenopus laevis GN=anxa7 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 3.186e-13
Identity = 44/133 (33.08%), Postives = 67/133 (50.38%), Query Frame = -3
Query:  216 KTSNDEDLIR-ILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGH 611
            K   DE     +LA+RS  Q+ A    Y  +   D+   +  +      D L+A +QC +    +F   L  ++   GTD+  L R++ TR+E+DL  IK  Y +     L  A+  DTSG Y++MLLA+ GH
Sbjct:  380 KLGTDESSFNLVLASRSFPQLKAVAEAYARISKRDLLSVIGREFSGYIEDGLKAVLQCAINRPLFFRDRLCRSMKGAGTDDSTLIRIIVTRSEIDLVQIKQAYVQMYQKSLSAAISSDTSGAYKRMLLAISGH 512          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA5_CYNPY (Annexin A5 OS=Cynops pyrrhogaster PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 3.186e-13
Identity = 42/136 (30.88%), Postives = 71/136 (52.21%), Query Frame = -3
Query:  210 NKTSNDED-LIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 614
            NK   DE+  I IL+TR    +    +QY  + G  I++ ++++    +  LL A V+ +   + Y  ++L  ++   GTD+  L RV+ +R+E+DL  I+  +++     L   +  DTSGDY   LL L G  D
Sbjct:  187 NKWGTDEETFISILSTRGVGHLRKVFDQYMTISGYQIEESIQSETGGHFEKLLLAVVKSIRSIQGYLAEVLYNSMKGAGTDDQTLIRVLVSRSEIDLFNIRQTFRKHYGKSLHAMIQSDTSGDYRNALLLLCGEID 322          

HSP 2 Score: 68.5514 bits (166), Expect = 2.982e-11
Identity = 40/128 (31.25%), Postives = 75/128 (58.59%), Query Frame = -3
Query:  222 DED-LIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKI-LRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALL 599
            DED ++++L +RS  Q       YK ++G D+  DL+++   ++  LL A    L+ P H ++   LR AI   GT E  +  ++ +R   ++K IK+ Y++     L++ +V DTSG++E++L++L+
Sbjct:   36 DEDTILKLLISRSNKQRQQIALTYKTLFGRDLTDDLKSELSGKFETLLVA----LMVPAHLYDACELRNAIKGLGTLENVIIEIMASRTAAEVKNIKETYKKEFDSDLEKDIVGDTSGNFERLLVSLV 159          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA5_PANTR (Annexin A5 OS=Pan troglodytes GN=ANXA5 PE=2 SV=3)

HSP 1 Score: 74.7146 bits (182), Expect = 4.162e-13
Identity = 41/132 (31.06%), Postives = 70/132 (53.03%), Query Frame = -3
Query:  210 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 605
            +++E  I I  TRS + +    ++Y  + G  I++ ++ +       LL A V+ +     Y  + L  A+   GTD+  L RV+ +R+E+DL  I+ E+++  +  L   +  DTSGDY+K LL L G  D
Sbjct:  189 TDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD 320          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA5_MOUSE (Annexin A5 OS=Mus musculus GN=Anxa5 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.162e-13
Identity = 42/132 (31.82%), Postives = 70/132 (53.03%), Query Frame = -3
Query:  210 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 605
            +++E  I I  TRS + +    ++Y  + G  I++ ++ +       LL A V+ +     Y  + L  A+   GTD+  L RVV +R+E+DL  I+ E+++  +  L   +  DTSGDY+K LL L G  D
Sbjct:  187 TDEEKFITIFGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVVVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGGED 318          
The following BLAST results are available for this feature:
BLAST of DC900049 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
ANXA5_RAT1.430e-1331.82Annexin A5 OS=Rattus norvegicus GN=Anxa5 PE=1 SV=3[more]
ANXA7_HUMAN1.868e-1333.88Annexin A7 OS=Homo sapiens GN=ANXA7 PE=1 SV=3[more]
ANXA1_PONAB1.868e-1333.88Annexin A1 OS=Pongo abelii GN=ANXA1 PE=2 SV=1[more]
ANXA1_PANTR1.868e-1333.88Annexin A1 OS=Pan troglodytes GN=ANXA1 PE=2 SV=1[more]
ANXA1_HUMAN1.868e-1333.88Annexin A1 OS=Homo sapiens GN=ANXA1 PE=1 SV=2[more]
ANXA1_RAT2.440e-1332.23Annexin A1 OS=Rattus norvegicus GN=Anxa1 PE=1 SV=2[more]
ANXA7_XENLA3.186e-1333.08Annexin A7 OS=Xenopus laevis GN=anxa7 PE=2 SV=1[more]
ANXA5_CYNPY3.186e-1330.88Annexin A5 OS=Cynops pyrrhogaster PE=2 SV=1[more]
ANXA5_PANTR4.162e-1331.06Annexin A5 OS=Pan troglodytes GN=ANXA5 PE=2 SV=3[more]
ANXA5_MOUSE4.162e-1331.82Annexin A5 OS=Mus musculus GN=Anxa5 PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900049 VSS Citrus sinensis cDNA clone VS27Q55 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900049 ID=DC900049|Name=DC900049|organism=Citrus sinensis|type=EST|length=622bp
AAAGTAGCAGTTTCATANCAAATGCTGTCACCATCTTATTTATAAGATCA
TAGATTAAGTTTTTCAACCGGCATAACCAAAAGACTGAAAATAAAACGAT
CATCACACATGGATAGAGAACACTGCAAACTCCAAGCAACAGCAAACCTA
GATAAATAAAACACATATATTGCCTCTCAATCCTTCAAGAAATAGGGAAC
AACTCAAGCATCCCCATGTCCTAAAAGTGCCAGAAGCATTTTTTCGTAGT
CCCCAGAGGTGTCCTTGACAACGGCGCGATCCAGAGGAACACTGTTCCTC
CTCTGGTACTCATCTTTTATGACCTTCAAGTCGACCTCGGCCCTTGTGGT
GACGACTCTAGTAAGAGCCCCTTCATCTGTTCCCTGTTTGTTAATTGCCA
GACGAAGTATCTTCTCAAAATAATGTTCAGGGCGGACTAAGCACTGAACT
GTGGCCCTCAGTAGGTCGAGGTACTCATCTTTAGGGTCAGCCTCTAAGTC
CTGATCAATATCATTCCCATATACATTCTTGTATTGATTCAGAGTCGCAT
TGATCTGNGCTTTGCTCCTTGTAGCCAAGATCCTGATGAGATCCTCATCA
TTGGAGGTCTTATTCGAAATCT
back to top