DC900049

Overview
NameDC900049
Unique NameDC900049
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length622
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4158 contig Csv1_Contig4158:637..1258. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA5_HUMAN (Annexin A5 OS=Homo sapiens GN=ANXA5 PE=1 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 4.162e-13
Identity = 41/132 (31.06%), Postives = 70/132 (53.03%), Query Frame = -3
Query:  210 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 605
            +++E  I I  TRS + +    ++Y  + G  I++ ++ +       LL A V+ +     Y  + L  A+   GTD+  L RV+ +R+E+DL  I+ E+++  +  L   +  DTSGDY+K LL L G  D
Sbjct:  189 TDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD 320          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA5_BOVIN (Annexin A5 OS=Bos taurus GN=ANXA5 PE=1 SV=3)

HSP 1 Score: 74.7146 bits (182), Expect = 4.162e-13
Identity = 42/132 (31.82%), Postives = 69/132 (52.27%), Query Frame = -3
Query:  210 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 605
            +++E  I I  TRS + +    ++Y  + G  I++ ++ +       LL A V+ +     Y  + L  A+   GTD+  L RVV +R+E+DL  I+ E+++     L   +  DTSGDY+K LL L G  D
Sbjct:  189 TDEEKFITIFGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVVVSRSEIDLYNIRKEFRKNFGTSLYSMIKGDTSGDYKKALLLLCGGED 320          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA7_MACFA (Annexin A7 OS=Macaca fascicularis GN=ANXA7 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 5.435e-13
Identity = 41/121 (33.88%), Postives = 63/121 (52.07%), Query Frame = -3
Query:  219 ILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 581
            ILATRS  Q+ AT+  Y  +   D+   +  +        L+  +QC +    +F + L  A+   GTD+  L R+V TR+E+DL  IK  + +     L   +  DTSGDY + LLA++G
Sbjct:  367 ILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYAMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRPLLAIVG 487          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA8_RABIT (Annexin A8 OS=Oryctolagus cuniculus GN=ANXA8 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 7.099e-13
Identity = 37/129 (28.68%), Postives = 68/129 (52.71%), Query Frame = -3
Query:  219 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 605
            +++   I IL TRS   +     +Y+ +    I+  ++++      + +   V+C      YF + L  A+   GT +G L R + +R+E+DL +IK  Y++     L   +++DTSGDY+  LL+L+G
Sbjct:  196 TDEMKFITILCTRSARHLMRVFEEYEKIANKSIEDSIKSETHGSLEEAMLTIVKCTRNLHCYFAERLHYAMKGAGTLDGTLIRNIVSRSEIDLNLIKGHYKKMYGKTLSSMIMEDTSGDYKNALLSLVG 324          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA5_MACFA (Annexin A5 OS=Macaca fascicularis GN=ANXA5 PE=2 SV=3)

HSP 1 Score: 73.9442 bits (180), Expect = 7.099e-13
Identity = 41/132 (31.06%), Postives = 70/132 (53.03%), Query Frame = -3
Query:  210 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 605
            +++E  I I  TRS + +    ++Y  + G  I++ ++ +       LL A V+ +     Y  + L  A+   GTD+  L RV+ +R+E+DL  I+ E+++  +  L   +  DTSGDY+K LL L G  D
Sbjct:  189 TDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLLNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGGED 320          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA8_BOVIN (Annexin A8 OS=Bos taurus GN=ANXA8 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 9.271e-13
Identity = 36/129 (27.91%), Postives = 69/129 (53.49%), Query Frame = -3
Query:  219 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 605
            +++   I IL TRS   +     +Y+ +    I+  ++++      + +   V+C      YF + L  A+   GT +G L R + +R+E+DL +IK+++++     L   +++DTSGDY+  LL L+G
Sbjct:  196 TDEMKFITILCTRSATHLMRVFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTRNLHGYFAERLYFAMKGAGTLDGTLIRNIVSRSEIDLNLIKNQFKKMYGKTLSSMIMEDTSGDYKNALLNLVG 324          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA1_PIG (Annexin A1 OS=Sus scrofa GN=ANXA1 PE=1 SV=3)

HSP 1 Score: 73.559 bits (179), Expect = 9.271e-13
Identity = 39/123 (31.71%), Postives = 67/123 (54.47%), Query Frame = -3
Query:  219 IRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 587
            I IL TRS   +     +Y     +D+++ L+ + K +  + L   V+C      +F + L  A+   GT    L R++ +R+E+D+  IK  YQ+   + L +A++ +T GDYEK+L+AL G
Sbjct:  222 ITILTTRSYLHLRRVFQKYSKYSKHDMNKVLDLELKGDIENCLTVVVKCATSKPMFFAEKLHQAMKGNGTRHKTLIRIMVSRSEIDMNDIKACYQKLYGISLCQAILDETKGDYEKILVALCG 344          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: AXA82_HUMAN (Annexin A8-like protein 2 OS=Homo sapiens GN=ANXA8L2 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.211e-12
Identity = 36/129 (27.91%), Postives = 68/129 (52.71%), Query Frame = -3
Query:  219 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 605
            +++   I IL TRS   +     +Y+ +    I+  ++++      + +   V+C      YF + L  A+   GT +G L R + +R+E+DL +IK  +++     L   +++DTSGDY+  LL+L+G
Sbjct:  196 TDEMKFITILCTRSATHLLRVFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIVSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVG 324          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: AXA81_HUMAN (Annexin A8-like protein 1 OS=Homo sapiens GN=ANXA8L1 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.211e-12
Identity = 36/129 (27.91%), Postives = 68/129 (52.71%), Query Frame = -3
Query:  219 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 605
            +++   I IL TRS   +     +Y+ +    I+  ++++      + +   V+C      YF + L  A+   GT +G L R + +R+E+DL +IK  +++     L   +++DTSGDY+  LL+L+G
Sbjct:  196 TDEMKFITILCTRSATHLLRVFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIVSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVG 324          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA8_PANTR (Annexin A8 OS=Pan troglodytes GN=ANXA8 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.211e-12
Identity = 36/129 (27.91%), Postives = 68/129 (52.71%), Query Frame = -3
Query:  219 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 605
            +++   I IL TRS   +     +Y+ +    I+  ++++      + +   V+C      YF + L  A+   GT +G L R + +R+E+DL +IK  +++     L   +++DTSGDY+  LL+L+G
Sbjct:  196 TDEMKFITILCTRSATHLLRVFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIVSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVG 324          
The following BLAST results are available for this feature:
BLAST of DC900049 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
ANXA5_HUMAN4.162e-1331.06Annexin A5 OS=Homo sapiens GN=ANXA5 PE=1 SV=2[more]
ANXA5_BOVIN4.162e-1331.82Annexin A5 OS=Bos taurus GN=ANXA5 PE=1 SV=3[more]
ANXA7_MACFA5.435e-1333.88Annexin A7 OS=Macaca fascicularis GN=ANXA7 PE=2 SV... [more]
ANXA8_RABIT7.099e-1328.68Annexin A8 OS=Oryctolagus cuniculus GN=ANXA8 PE=2 ... [more]
ANXA5_MACFA7.099e-1331.06Annexin A5 OS=Macaca fascicularis GN=ANXA5 PE=2 SV... [more]
ANXA8_BOVIN9.271e-1327.91Annexin A8 OS=Bos taurus GN=ANXA8 PE=2 SV=1[more]
ANXA1_PIG9.271e-1331.71Annexin A1 OS=Sus scrofa GN=ANXA1 PE=1 SV=3[more]
AXA82_HUMAN1.211e-1227.91Annexin A8-like protein 2 OS=Homo sapiens GN=ANXA8... [more]
AXA81_HUMAN1.211e-1227.91Annexin A8-like protein 1 OS=Homo sapiens GN=ANXA8... [more]
ANXA8_PANTR1.211e-1227.91Annexin A8 OS=Pan troglodytes GN=ANXA8 PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900049 VSS Citrus sinensis cDNA clone VS27Q55 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900049 ID=DC900049|Name=DC900049|organism=Citrus sinensis|type=EST|length=622bp
AAAGTAGCAGTTTCATANCAAATGCTGTCACCATCTTATTTATAAGATCA
TAGATTAAGTTTTTCAACCGGCATAACCAAAAGACTGAAAATAAAACGAT
CATCACACATGGATAGAGAACACTGCAAACTCCAAGCAACAGCAAACCTA
GATAAATAAAACACATATATTGCCTCTCAATCCTTCAAGAAATAGGGAAC
AACTCAAGCATCCCCATGTCCTAAAAGTGCCAGAAGCATTTTTTCGTAGT
CCCCAGAGGTGTCCTTGACAACGGCGCGATCCAGAGGAACACTGTTCCTC
CTCTGGTACTCATCTTTTATGACCTTCAAGTCGACCTCGGCCCTTGTGGT
GACGACTCTAGTAAGAGCCCCTTCATCTGTTCCCTGTTTGTTAATTGCCA
GACGAAGTATCTTCTCAAAATAATGTTCAGGGCGGACTAAGCACTGAACT
GTGGCCCTCAGTAGGTCGAGGTACTCATCTTTAGGGTCAGCCTCTAAGTC
CTGATCAATATCATTCCCATATACATTCTTGTATTGATTCAGAGTCGCAT
TGATCTGNGCTTTGCTCCTTGTAGCCAAGATCCTGATGAGATCCTCATCA
TTGGAGGTCTTATTCGAAATCT
back to top