DC900048

Overview
NameDC900048
Unique NameDC900048
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length644
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4158 contig Csv1_Contig4158:7..650. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA7_BOVIN (Annexin A7 OS=Bos taurus GN=ANXA7 PE=1 SV=2)

HSP 1 Score: 98.9821 bits (245), Expect = 2.236e-20
Identity = 53/153 (34.64%), Postives = 88/153 (57.52%), Query Frame = 3
Query:   81 QGDHETMSTLTVPAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            QG H T+     PA       D E LRKA +G+GT+EQ II ++A+R+  QR+ I+  +   YG+DL+K L  EL+ + E +++   +     DA+    A K   +  +VL+EI CTR+++++ E  + Y + F + LE+D+   T+G F +
Sbjct:  148 QGTHGTIR----PAANFDAMRDAEVLRKAMKGFGTDEQAIIDVVANRSNDQRQKIKAAFKTMYGKDLIKDLKSELSGNMEELILALFMPSTYYDAWSLRNAMKGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFER 296          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA7_HUMAN (Annexin A7 OS=Homo sapiens GN=ANXA7 PE=1 SV=3)

HSP 1 Score: 98.5969 bits (244), Expect = 2.920e-20
Identity = 48/141 (34.04%), Postives = 86/141 (60.99%), Query Frame = 3
Query:  117 PAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            PA       D E LRKA +G+GT+EQ I+ ++A+R+  QR+ I+  +  +YG+DL+K L  EL+ + E +++   + P   DA+   +A +   +  +VL+EI CTR+++++ E  + Y + F + LE+D+   T+G F +
Sbjct:  181 PAANFDAIRDAEILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFER 321          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA3_RAT (Annexin A3 OS=Rattus norvegicus GN=Anxa3 PE=1 SV=4)

HSP 1 Score: 98.5969 bits (244), Expect = 2.920e-20
Identity = 55/141 (39.01%), Postives = 84/141 (59.57%), Query Frame = 3
Query:  117 PAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            P   PSV  D E +RKA +G GT+E+ +I+IL  R+ AQR+LI + Y + Y + L   L  +L+  FE V++     PA  DA    ++ +   +    L+EI  TR+S+Q+ E  QAY+  +KK+L +D+   T+GDFRK
Sbjct:   17 PGFNPSV--DAEAIRKAIKGIGTDEKTLINILTERSNAQRQLIVKQYQEAYEQALKADLKGDLSGHFEHVMVALITAPAVFDAKQLKKSMRGMGTDEDTLIEILTTRTSRQMKEISQAYYTAYKKNLRDDISSETSGDFRK 155          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANX13_HUMAN (Annexin A13 OS=Homo sapiens GN=ANXA13 PE=1 SV=3)

HSP 1 Score: 97.0561 bits (240), Expect = 8.497e-20
Identity = 51/135 (37.78%), Postives = 82/135 (60.74%), Query Frame = 3
Query:  135 VTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            V  D ++L KA +G GTNE  II IL+ R + +R+ I+Q Y  TYG++L + L  EL+ +FE+  +     P+E  A    +A K   +   VL+E+ CTR++K+++  ++AY   F +SLE DV   T+G+ +K
Sbjct:   16 VDRDAKKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKSELSGNFEKTALALLDRPSEYAARQLQKAMKGLGTDESVLIEVLCTRTNKEIIAIKEAYQRLFDRSLESDVKGDTSGNLKK 150          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANX13_CANFA (Annexin A13 OS=Canis familiaris GN=ANXA13 PE=1 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 1.893e-19
Identity = 50/134 (37.31%), Postives = 81/134 (60.45%), Query Frame = 3
Query:  135 VTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFR 536
            V  D ++L KA +G GT+E  II IL+ R + +R+ I+Q Y  TYG+DL +    +L+ +FE+  +     P+E DA    +A K   +   VL+EI CTR++K+++  ++AY   F +SLE DV   T+G+ +
Sbjct:   16 VDHDAKKLNKACKGMGTDEAAIIEILSSRTSDERQQIKQKYKATYGKDLEEVFKSDLSGNFEKTALALLDRPSEYDARQLQKAMKGLGTDEAVLIEILCTRTNKEIMAIKEAYQRLFDRSLESDVKADTSGNLK 149          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANX11_RABIT (Annexin A11 OS=Oryctolagus cuniculus GN=ANXA11 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.893e-19
Identity = 51/132 (38.64%), Postives = 78/132 (59.09%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            D E LRKA +G+GT+EQ II  L  R+  QR+ I  ++   YG+DL+K L  EL+ +FE+ ++     P   DA+   EA K   +    L+EI  +RS++ + E  +AY   FKK+LEE +   T+G F++
Sbjct:  203 DAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPILFDAYEIKEAIKGAGTDEACLIEILASRSNEHIRELNKAYKTEFKKTLEEAIRSDTSGHFQR 334          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANX11_HUMAN (Annexin A11 OS=Homo sapiens GN=ANXA11 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.893e-19
Identity = 51/132 (38.64%), Postives = 78/132 (59.09%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            D E LRKA +G+GT+EQ II  L  R+  QR+ I  ++   YG+DL+K L  EL+ +FE+ ++     P   D +   EA K   +    L+EI  +RS++ + E  +AY A FKK+LEE +   T+G F++
Sbjct:  205 DAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYEIKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQR 336          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA6_BOVIN (Annexin A6 OS=Bos taurus GN=ANXA6 PE=1 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 4.217e-19
Identity = 49/132 (37.12%), Postives = 79/132 (59.85%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            D + LRKA +G GT+E  II I+AHR+ AQR+ IRQT+   +G DL+  L  EL+ D  R+++   + PA  DA    +A +   +  + L+EI  TR++ ++    +AY   + KSLE+ +   T+G F++
Sbjct:  368 DAKALRKAMKGLGTDEDTIIDIIAHRSNAQRQQIRQTFKSHFGRDLMADLKSELSGDLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIQAINKAYKEDYHKSLEDALSSDTSGHFKR 499          

HSP 2 Score: 82.4185 bits (202), Expect = 2.166e-15
Identity = 44/134 (32.84%), Postives = 77/134 (57.46%), Query Frame = 3
Query:  138 TEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            ++D E L  A +G+G++++ I+ ++  R+  QR+ I Q Y   YG+DL+  L  ELT  FER+++     PA  DA    +A     +  + L+EI  +R+++Q+ +   AY   +++ LE D+   T+G FRK
Sbjct:   23 SQDAETLYNAMKGFGSDKEAILELITSRSNRQRQEICQNYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYADAKEIKDAISGIGTDEKCLIEILASRTNEQIHQLVAAYKDAYERDLEADITGDTSGHFRK 156          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANX11_BOVIN (Annexin A11 OS=Bos taurus GN=ANXA11 PE=1 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 4.217e-19
Identity = 50/132 (37.88%), Postives = 77/132 (58.33%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            D E LRKA +G+GT+EQ II  L  R+  QR+ I  ++   YG+DL+K L  EL+ +FE+ ++     P   DA+   EA K   +    L+EI  +RS++ + E  + Y   FKK+LEE +   T+G F++
Sbjct:  203 DAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDAYEIKEAIKGAGTDEACLIEILASRSNEHIRELNRVYKTEFKKTLEEAIRSDTSGHFQR 334          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA3_BOVIN (Annexin A3 OS=Bos taurus GN=ANXA3 PE=2 SV=3)

HSP 1 Score: 94.3597 bits (233), Expect = 5.507e-19
Identity = 54/137 (39.42%), Postives = 80/137 (58.39%), Query Frame = 3
Query:  129 PSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            PSV  D E +RKA  G GT+E+ +ISIL  R  AQR LI + Y    G++L   L  +L+  F+ +++     PA  DA    ++ K   ++   L+EI  TR+SKQ+ E   AY+  +KKSL +++   T+GDFRK
Sbjct:   20 PSV--DAEAIRKAIRGIGTDEKTLISILTERTNAQRLLIAKEYQALCGKELKDDLKGDLSGHFKHLMVALVTPPAVFDAKQLKKSMKGMGTNEDALIEILTTRTSKQMQEIGHAYYTAYKKSLGDEISSETSGDFRK 154          
The following BLAST results are available for this feature:
BLAST of DC900048 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 84
Match NameE-valueIdentityDescription
ANXA7_BOVIN2.236e-2034.64Annexin A7 OS=Bos taurus GN=ANXA7 PE=1 SV=2[more]
ANXA7_HUMAN2.920e-2034.04Annexin A7 OS=Homo sapiens GN=ANXA7 PE=1 SV=3[more]
ANXA3_RAT2.920e-2039.01Annexin A3 OS=Rattus norvegicus GN=Anxa3 PE=1 SV=4[more]
ANX13_HUMAN8.497e-2037.78Annexin A13 OS=Homo sapiens GN=ANXA13 PE=1 SV=3[more]
ANX13_CANFA1.893e-1937.31Annexin A13 OS=Canis familiaris GN=ANXA13 PE=1 SV=... [more]
ANX11_RABIT1.893e-1938.64Annexin A11 OS=Oryctolagus cuniculus GN=ANXA11 PE=... [more]
ANX11_HUMAN1.893e-1938.64Annexin A11 OS=Homo sapiens GN=ANXA11 PE=1 SV=1[more]
ANXA6_BOVIN4.217e-1937.12Annexin A6 OS=Bos taurus GN=ANXA6 PE=1 SV=2[more]
ANX11_BOVIN4.217e-1937.88Annexin A11 OS=Bos taurus GN=ANXA11 PE=1 SV=1[more]
ANXA3_BOVIN5.507e-1939.42Annexin A3 OS=Bos taurus GN=ANXA3 PE=2 SV=3[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900048 VSS Citrus sinensis cDNA clone VS27Q55 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900048 ID=DC900048|Name=DC900048|organism=Citrus sinensis|type=EST|length=644bp
GTCCTTCTTGNGTAGAGAGTCTCGTTCTCGATTCTGCGCAGCACACAGAA
TCAGATTTGAGTTAAGTTCTGAAAGAAGAACAAGGAGATCACGAAACAAT
GTCAACACTTACAGTTCCAGCGCAAGTTCCATCTGTTACCGAAGACTGTG
AGCAGCTCAGAAAAGCCTTTGAAGGATGGGGAACAAACGAGCAACTGATC
ATATCGATACTGGCTCACAGAAATGCTGCTCAACGCAAGTTGATTCGACA
AACATATGCTGATACTTACGGCGAAGACCTCCTCAAGTCGCTCGATAAGG
AACTCACTAATGACTTTGAGAGGGTGGTGATGCTCTGGACTCTTGATCCT
GCTGAACGTGATGCCTTTTTGGCTAATGAAGCCACTAAGAGGTGGACTTC
TAGCAACCAGGTTCTTATGGAAATTGCATGCACCAGGTCTTCGAAGCAAT
TGCTCGAAGCAAGGCAGGCTTATCATGCTCGTTTTAAGAAGTCCCTTGAA
GAGGATGTTGGTTATCACACCAATGGGGACTTCCGCAAGCTTTTGCTACC
CTTGTGACTGNCTACCGATATGAGGGTGATGAGGNGACATTACACTTGCA
AATCAGAAGCTAGATTTCATGAGAGATTCGATAGACTACATGAT
back to top