DC900048

Overview
NameDC900048
Unique NameDC900048
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length644
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4158 contig Csv1_Contig4158:7..650. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA6_MOUSE (Annexin A6 OS=Mus musculus GN=Anxa6 PE=1 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 1.602e-18
Identity = 48/132 (36.36%), Postives = 78/132 (59.09%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            D + LRKA +G GT+E  II I+ HR+ AQR+ IRQT+   +G DL+  L  E++ D  R+++   + PA  DA    +A +   +  + L+EI  TR++ ++    +AY   + KSLE+ +   T+G FR+
Sbjct:  368 DAKALRKAMKGIGTDEATIIDIVTHRSNAQRQQIRQTFKSHFGRDLMADLKSEISGDLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKTLIEILATRTNAEIRAINEAYKEDYHKSLEDALSSDTSGHFRR 499          

HSP 2 Score: 76.2554 bits (186), Expect = 1.552e-13
Identity = 42/133 (31.58%), Postives = 77/133 (57.89%), Query Frame = 3
Query:  141 EDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            +D E L  A +G+G++++ I+ ++  R+  QR+ I Q+Y   YG+DL++ L  ELT  FER+++      A  DA    +A     +  + L+EI  +R+++Q+ +   AY   +++ LE D+   T+G F+K
Sbjct:   24 QDAEALYTAMKGFGSDKESILELITSRSNKQRQEICQSYKSLYGKDLIEDLKYELTGKFERLIVNLMRPLAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYERDLESDIIGDTSGHFQK 156          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA6_HUMAN (Annexin A6 OS=Homo sapiens GN=ANXA6 PE=1 SV=3)

HSP 1 Score: 92.8189 bits (229), Expect = 1.602e-18
Identity = 49/141 (34.75%), Postives = 80/141 (56.74%), Query Frame = 3
Query:  117 PAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            PA   +   D + LRKA +G GT+E  II I+ HR+  QR+ IRQT+   +G DL+  L  E++ D  R+++   + PA  DA    +A +   +  + L+EI  TR++ ++    +AY   + KSLE+ +   T+G FR+
Sbjct:  359 PANDFNPDADAKALRKAMKGLGTDEDTIIDIITHRSNVQRQQIRQTFKSHFGRDLMTDLKSEISGDLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIRAINEAYKEDYHKSLEDALSSDTSGHFRR 499          

HSP 2 Score: 79.337 bits (194), Expect = 1.833e-14
Identity = 43/133 (32.33%), Postives = 77/133 (57.89%), Query Frame = 3
Query:  141 EDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            +D E L  A +G+G++++ I+ I+  R+  QR+ + Q+Y   YG+DL+  L  ELT  FER+++     PA  DA    +A     +  + L+EI  +R+++Q+ +   AY   +++ LE D+   T+G F+K
Sbjct:   24 QDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYERDLEADIIGDTSGHFQK 156          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANX13_MOUSE (Annexin A13 OS=Mus musculus GN=Anxa13 PE=2 SV=3)

HSP 1 Score: 92.8189 bits (229), Expect = 1.602e-18
Identity = 49/132 (37.12%), Postives = 81/132 (61.36%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            D ++L KA +G GT+E  II +L+ R + +R+ I+Q Y + YG+DL + L+ EL+ +F++  +     P E  A    +A K   +   +L+EI CTRS+K+++  ++AY   F +SLE DV   T+G+ RK
Sbjct:   20 DAKKLYKACKGMGTDEAAIIEVLSSRTSEERQQIKQKYKEKYGKDLEEVLNSELSGNFKKTALALLDRPNEYAARQLQKAMKGVGTDEAMLIEILCTRSNKEIVAIKEAYQRLFGRSLESDVKEDTSGNLRK 151          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA7_MOUSE (Annexin A7 OS=Mus musculus GN=Anxa7 PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.093e-18
Identity = 45/142 (31.69%), Postives = 84/142 (59.15%), Query Frame = 3
Query:  114 VPAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            +PA       D E LRKA +G+GT+EQ I+ ++++R+  QR+ I+  +   YG+DL+K L  EL+ + E +++   +     DA+   +A +   +  +VL+EI CTR+++++ +  + Y   F + LE+D+   T+G F +
Sbjct:  155 LPASNFDAMRDAEILRKAMKGFGTDEQAIVDVVSNRSNDQRQQIKAAFKTMYGKDLIKDLKSELSGNMEELILALFMPSTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIRDIVRCYQLEFGRDLEKDIRSDTSGHFER 296          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANX11_MOUSE (Annexin A11 OS=Mus musculus GN=Anxa11 PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.093e-18
Identity = 49/132 (37.12%), Postives = 77/132 (58.33%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            D E LRKA +G+GT+EQ II  L  R+  QR+ I  ++   YG+DL+K L  EL+ +FE+ ++     P   D +   EA K   +    L+EI  +RS++ + E  +AY   F+K+LEE +   T+G F++
Sbjct:  203 DAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDVYEIKEAIKGAGTDEACLIEIFASRSNEHIRELSRAYKTEFQKTLEEAIRSDTSGHFQR 334          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA4_MOUSE (Annexin A4 OS=Mus musculus GN=Anxa4 PE=2 SV=3)

HSP 1 Score: 91.2781 bits (225), Expect = 4.662e-18
Identity = 50/136 (36.76%), Postives = 78/136 (57.35%), Query Frame = 3
Query:  132 SVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            + TED + LRKA +G GT+E  II ILA+RN AQR+ IR  Y  T G DL++ L  EL+++FE+V++         D      A K   +    L+EI  +R+ +++    Q Y  ++ +SLEED+   T+  F++
Sbjct:   15 NATEDAQTLRKAMKGLGTDEDAIIGILAYRNTAQRQEIRSAYKSTIGRDLIEDLKSELSSNFEQVILGLMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRINQTYQQQYGRSLEEDICSDTSFMFQR 150          

HSP 2 Score: 69.3218 bits (168), Expect = 1.897e-11
Identity = 46/147 (31.29%), Postives = 74/147 (50.34%), Query Frame = 3
Query:  129 PSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWT---------LDPA--ERDAFLANEA-TKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDF 533
            P+V  D ++LR+A +G GT+E  +I ILA R   + + I QTY   YG  L + +  + +  F+RV++  +         LD A  ++DA    EA  KRW +     + I C+R+   LL     Y    +K +E+ +   T+G F
Sbjct:   86 PTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRINQTYQQQYGRSLEEDICSDTSFMFQRVLVFLSAAGRDEGNYLDDALMKQDAQELYEAGEKRWGTDEVKFLSILCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSF 232          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA4_RAT (Annexin A4 OS=Rattus norvegicus GN=Anxa4 PE=1 SV=3)

HSP 1 Score: 89.3521 bits (220), Expect = 1.772e-17
Identity = 50/136 (36.76%), Postives = 77/136 (56.62%), Query Frame = 3
Query:  132 SVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            + TED + LRKA +G GT+E  II +LA RN AQR+ IR  Y  T G DLL+ L  EL+++FE+V++         D      A K   +    L+EI  +R+ +++    Q Y  ++ +SLEED+   T+  F++
Sbjct:   15 NATEDAQVLRKAMKGLGTDEDAIIGVLACRNTAQRQEIRTAYKSTIGRDLLEDLKSELSSNFEQVILGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRNPEEIRRINQTYQQQYGRSLEEDICSDTSFMFQR 150          

HSP 2 Score: 72.0182 bits (175), Expect = 2.927e-12
Identity = 44/147 (29.93%), Postives = 72/147 (48.98%), Query Frame = 3
Query:  129 PSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAER-----DAFLANEA-------TKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDF 533
            P+V  D ++LR+A +G GT+E  +I ILA RN  + + I QTY   YG  L + +  + +  F+RV++  T    +      DA +  +A        KRW +     + I C+R+   LL     Y    +K +E+ +   T+G F
Sbjct:   86 PTVLYDVQELRRAMKGAGTDEGCLIEILASRNPEEIRRINQTYQQQYGRSLEEDICSDTSFMFQRVLVSLTAGGRDEGNYLDDALVRQDAQDLYEAGEKRWGTDEVKFLSILCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSF 232          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA8_RABIT (Annexin A8 OS=Oryctolagus cuniculus GN=ANXA8 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.314e-17
Identity = 48/128 (37.50%), Postives = 75/128 (58.59%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNG 527
            D E L KA +G GTNEQ II +L  R++AQR+ I +++   +G DL ++L  EL+  FER+++     P   +A   ++A K   +   V++EI  +R+  QL E  +AY   +  SLEED+   T+G
Sbjct:   26 DAETLYKAMKGIGTNEQAIIDVLTRRSSAQRQQIAKSFKAQFGSDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLQEIMKAYEEDYGSSLEEDIQADTSG 153          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXD4_ARATH (Annexin D4 OS=Arabidopsis thaliana GN=ANN4 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 5.155e-17
Identity = 52/154 (33.77%), Postives = 84/154 (54.55%), Query Frame = 3
Query:  108 LTVPAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDK-------ELTNDFER---VVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            + +P ++ S+TE       A  G G +E  +IS L       RKL R+     + ED  ++ +K        L  +F R    V++W + P ERDA L  +A K+   +  +++E++CTRS++ LL AR+AYH+ F +S+EED+  H +G  RK
Sbjct:    1 MALPLELESLTEAIS----AGMGMGVDENALISTLGKSQKEHRKLFRKASKSFFVEDEERAFEKCHDHFVRHLKLEFSRFNTAVVMWAMHPWERDARLVKKALKKGEEAYNLIVEVSCTRSAEDLLGARKAYHSLFDQSMEEDIASHVHGPQRK 150          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA4_PIG (Annexin A4 OS=Sus scrofa GN=ANXA4 PE=1 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 6.732e-17
Identity = 48/136 (35.29%), Postives = 76/136 (55.88%), Query Frame = 3
Query:  132 SVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            +  ED + LRKA +G GT+E  IIS+LA+R+ AQR+ IR  Y  T G DLL  L  EL+ +FE+V++         D      A K   +    L+EI  +R+ +++    Q Y  ++ +SLE+D+   T+  F++
Sbjct:   15 NAAEDAQTLRKAMKGLGTDEDAIISVLAYRSTAQRQEIRTAYKSTIGRDLLDDLKSELSGNFEQVILGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRINQTYQLQYGRSLEDDIRSDTSFMFQR 150          
The following BLAST results are available for this feature:
BLAST of DC900048 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 84
Match NameE-valueIdentityDescription
ANXA6_MOUSE1.602e-1836.36Annexin A6 OS=Mus musculus GN=Anxa6 PE=1 SV=2[more]
ANXA6_HUMAN1.602e-1834.75Annexin A6 OS=Homo sapiens GN=ANXA6 PE=1 SV=3[more]
ANX13_MOUSE1.602e-1837.12Annexin A13 OS=Mus musculus GN=Anxa13 PE=2 SV=3[more]
ANXA7_MOUSE2.093e-1831.69Annexin A7 OS=Mus musculus GN=Anxa7 PE=2 SV=1[more]
ANX11_MOUSE2.093e-1837.12Annexin A11 OS=Mus musculus GN=Anxa11 PE=1 SV=1[more]
ANXA4_MOUSE4.662e-1836.76Annexin A4 OS=Mus musculus GN=Anxa4 PE=2 SV=3[more]
ANXA4_RAT1.772e-1736.76Annexin A4 OS=Rattus norvegicus GN=Anxa4 PE=1 SV=3[more]
ANXA8_RABIT2.314e-1737.50Annexin A8 OS=Oryctolagus cuniculus GN=ANXA8 PE=2 ... [more]
ANXD4_ARATH5.155e-1733.77Annexin D4 OS=Arabidopsis thaliana GN=ANN4 PE=2 SV... [more]
ANXA4_PIG6.732e-1735.29Annexin A4 OS=Sus scrofa GN=ANXA4 PE=1 SV=2[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900048 VSS Citrus sinensis cDNA clone VS27Q55 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900048 ID=DC900048|Name=DC900048|organism=Citrus sinensis|type=EST|length=644bp
GTCCTTCTTGNGTAGAGAGTCTCGTTCTCGATTCTGCGCAGCACACAGAA
TCAGATTTGAGTTAAGTTCTGAAAGAAGAACAAGGAGATCACGAAACAAT
GTCAACACTTACAGTTCCAGCGCAAGTTCCATCTGTTACCGAAGACTGTG
AGCAGCTCAGAAAAGCCTTTGAAGGATGGGGAACAAACGAGCAACTGATC
ATATCGATACTGGCTCACAGAAATGCTGCTCAACGCAAGTTGATTCGACA
AACATATGCTGATACTTACGGCGAAGACCTCCTCAAGTCGCTCGATAAGG
AACTCACTAATGACTTTGAGAGGGTGGTGATGCTCTGGACTCTTGATCCT
GCTGAACGTGATGCCTTTTTGGCTAATGAAGCCACTAAGAGGTGGACTTC
TAGCAACCAGGTTCTTATGGAAATTGCATGCACCAGGTCTTCGAAGCAAT
TGCTCGAAGCAAGGCAGGCTTATCATGCTCGTTTTAAGAAGTCCCTTGAA
GAGGATGTTGGTTATCACACCAATGGGGACTTCCGCAAGCTTTTGCTACC
CTTGTGACTGNCTACCGATATGAGGGTGATGAGGNGACATTACACTTGCA
AATCAGAAGCTAGATTTCATGAGAGATTCGATAGACTACATGAT
back to top