DC900048

Overview
NameDC900048
Unique NameDC900048
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length644
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4158 contig Csv1_Contig4158:7..650. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA4_HUMAN (Annexin A4 OS=Homo sapiens GN=ANXA4 PE=1 SV=4)

HSP 1 Score: 87.4261 bits (215), Expect = 6.732e-17
Identity = 48/133 (36.09%), Postives = 75/133 (56.39%), Query Frame = 3
Query:  141 EDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            ED + LRKA +G GT+E  IIS+LA+RN AQR+ IR  Y  T G DL+  L  EL+ +FE+V++         D      A K   +    L+EI  +R+ +++    Q Y  ++ +SLE+D+   T+  F++
Sbjct:   18 EDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQR 150          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA4_CANFA (Annexin A4 OS=Canis familiaris GN=ANXA4 PE=1 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 6.732e-17
Identity = 52/141 (36.88%), Postives = 77/141 (54.61%), Query Frame = 3
Query:  117 PAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            PA   S TED + LRKA +G GT+E  IIS+LA RN +QR+ IR  Y  T G DL+  L  EL+ +FERV++         D      A K   +    L+EI  +R+ ++L    Q Y  ++ +SLE+ +   T+  F++
Sbjct:   10 PASGFSATEDAQTLRKAMKGLGTDEDAIISVLAPRNTSQRQEIRTAYKSTIGRDLMDDLKSELSGNFERVIVGMITPTVLYDVQELRRAMKGSGTDEGCLIEILASRTPEELRCINQTYQLQYGRSLEDVIRSDTSFMFQR 150          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA6_RAT (Annexin A6 OS=Rattus norvegicus GN=Anxa6 PE=1 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 8.793e-17
Identity = 45/132 (34.09%), Postives = 76/132 (57.58%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            D + LRKA +G GT+E  II I+  R+  QR+ IRQT+   +G DL+  L  E++ D  R+++   + PA  DA    +A +   +  + L+EI  TR++ ++    +AY   + KSLE+ +   T+G F++
Sbjct:  368 DAKGLRKAMKGIGTDEATIIDIITQRSNVQRQQIRQTFKSHFGRDLMADLKSEISGDLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIRAINEAYKEDYHKSLEDALSSDTSGHFKR 499          

HSP 2 Score: 75.485 bits (184), Expect = 2.647e-13
Identity = 42/133 (31.58%), Postives = 76/133 (57.14%), Query Frame = 3
Query:  141 EDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            +D E L  A +G+G++++ I+ ++  R+  QR+ I Q+Y   YG+DL+  L  ELT  FER+++      A  DA    +A     +  + L+EI  +R+++Q+ +   AY   +++ LE D+   T+G F+K
Sbjct:   24 QDAEALYTAMKGFGSDKESILELITSRSNKQRQEICQSYKSLYGKDLIADLKYELTGKFERLIVNLMRPLAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQIHQLVAAYKDAYERDLESDIIGDTSGHFQK 156          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA8_PANTR (Annexin A8 OS=Pan troglodytes GN=ANXA8 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.148e-16
Identity = 47/128 (36.72%), Postives = 74/128 (57.81%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNG 527
            D E L KA +G GTNEQ II +L  R+  QR+ I +++   +G+DL ++L  EL+  FER+++     P   +A   ++A K   +   V++EI  +R+  QL E  +AY   +  SLEED+   T+G
Sbjct:   26 DAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKSLGTKEGVIIEILASRTKNQLREIMKAYEEDYGSSLEEDIQADTSG 153          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: AXA82_HUMAN (Annexin A8-like protein 2 OS=Homo sapiens GN=ANXA8L2 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.500e-16
Identity = 47/128 (36.72%), Postives = 74/128 (57.81%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNG 527
            D E L KA +G GTNEQ II +L  R+  QR+ I +++   +G+DL ++L  EL+  FER+++     P   +A   ++A K   +   V++EI  +R+  QL E  +AY   +  SLEED+   T+G
Sbjct:   26 DAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEEDYGSSLEEDIQADTSG 153          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA8_HUMAN (Annexin A8 OS=Homo sapiens GN=ANXA8 PE=1 SV=3)

HSP 1 Score: 86.2705 bits (212), Expect = 1.500e-16
Identity = 47/128 (36.72%), Postives = 74/128 (57.81%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNG 527
            D E L KA +G GTNEQ II +L  R+  QR+ I +++   +G+DL ++L  EL+  FER+++     P   +A   ++A K   +   V++EI  +R+  QL E  +AY   +  SLEED+   T+G
Sbjct:   26 DAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEEDYGSSLEEDIQADTSG 153          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA8_BOVIN (Annexin A8 OS=Bos taurus GN=ANXA8 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.500e-16
Identity = 47/128 (36.72%), Postives = 75/128 (58.59%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNG 527
            D E L KA +G GTNEQ II +L  R+ AQR+ I +++   +G+DL+++L  EL+  FER+++     P   +A    +A K   +   V++EI  +R+  QL E  +AY   +  +LEED+   T+G
Sbjct:   26 DAETLYKAMKGIGTNEQAIIDVLTKRSNAQRQQIAKSFKAQFGKDLIETLKSELSGKFERLIIALMYPPYRYEAKELYDAMKGIGTKEGVIIEILASRTKNQLQEIMKAYEEDYGSNLEEDIKADTSG 153          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA6_CHICK (Annexin A6 OS=Gallus gallus GN=ANXA6 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.558e-16
Identity = 46/132 (34.85%), Postives = 74/132 (56.06%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            D + LRKA +G GT+E  II +L  R+ AQR+ I + Y   YG DLL  L  EL+     +++   L PA+ DA    +A +   +    L+EI  TR+++++    +AY   + KSLE+D+   T+  F++
Sbjct:  366 DAQVLRKAMKGLGTDEGAIIEVLTQRSNAQRQQILKAYKAHYGRDLLADLKSELSGSLANLILGLMLTPAQYDAKQLRKAVEGDGTDESTLVEIMATRNNQEIAAINEAYQQAYHKSLEDDLSSDTSVHFKR 497          

HSP 2 Score: 77.411 bits (189), Expect = 6.967e-14
Identity = 42/136 (30.88%), Postives = 76/136 (55.88%), Query Frame = 3
Query:  132 SVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            + ++D + L  A +G+G+++  I+ ++  R+  QR  I Q Y   YG+DL+  L  ELT  FER+++     PA  DA    +A     +  + L+EI  +R+++++ +   AY   +++ LE DV   T+G F+K
Sbjct:   19 NASQDADALCNAMKGFGSDKDAILDLITSRSNKQRLEICQAYKSQYGKDLIADLKYELTGKFERLIVSLMRPPAYSDAKEIKDAIAGIGTDEKCLIEILASRTNQEIHDLVAAYKDAYERDLEADVVGDTSGHFKK 154          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA4_BOVIN (Annexin A4 OS=Bos taurus GN=ANXA4 PE=1 SV=2)

HSP 1 Score: 85.5001 bits (210), Expect = 2.558e-16
Identity = 46/136 (33.82%), Postives = 77/136 (56.62%), Query Frame = 3
Query:  132 SVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            +  ED + LRKA +G GT+E  II++LA+R+ AQR+ IR  Y  T G DL+  L  EL+ +FE+V++         D     +A K   +    L+EI  +R+ +++    Q Y  ++ +SLE+D+   T+  F++
Sbjct:   15 NAAEDAQTLRKAMKGLGTDEDAIINVLAYRSTAQRQEIRTAYKTTIGRDLMDDLKSELSGNFEQVILGMMTPTVLYDVQELRKAMKGAGTDEGCLIEILASRTPEEIRRINQTYQLQYGRSLEDDIRSDTSFMFQR 150          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: AXA81_HUMAN (Annexin A8-like protein 1 OS=Homo sapiens GN=ANXA8L1 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.364e-16
Identity = 46/128 (35.94%), Postives = 74/128 (57.81%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNG 527
            D E L +A +G GTNEQ II +L  R+  QR+ I +++   +G+DL ++L  EL+  FER+++     P   +A   ++A K   +   V++EI  +R+  QL E  +AY   +  SLEED+   T+G
Sbjct:   26 DAETLYQAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEEDYGSSLEEDIQADTSG 153          
The following BLAST results are available for this feature:
BLAST of DC900048 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 84
Match NameE-valueIdentityDescription
ANXA4_HUMAN6.732e-1736.09Annexin A4 OS=Homo sapiens GN=ANXA4 PE=1 SV=4[more]
ANXA4_CANFA6.732e-1736.88Annexin A4 OS=Canis familiaris GN=ANXA4 PE=1 SV=2[more]
ANXA6_RAT8.793e-1734.09Annexin A6 OS=Rattus norvegicus GN=Anxa6 PE=1 SV=2[more]
ANXA8_PANTR1.148e-1636.72Annexin A8 OS=Pan troglodytes GN=ANXA8 PE=2 SV=1[more]
AXA82_HUMAN1.500e-1636.72Annexin A8-like protein 2 OS=Homo sapiens GN=ANXA8... [more]
ANXA8_HUMAN1.500e-1636.72Annexin A8 OS=Homo sapiens GN=ANXA8 PE=1 SV=3[more]
ANXA8_BOVIN1.500e-1636.72Annexin A8 OS=Bos taurus GN=ANXA8 PE=2 SV=1[more]
ANXA6_CHICK2.558e-1634.85Annexin A6 OS=Gallus gallus GN=ANXA6 PE=2 SV=1[more]
ANXA4_BOVIN2.558e-1633.82Annexin A4 OS=Bos taurus GN=ANXA4 PE=1 SV=2[more]
AXA81_HUMAN4.364e-1635.94Annexin A8-like protein 1 OS=Homo sapiens GN=ANXA8... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900048 VSS Citrus sinensis cDNA clone VS27Q55 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900048 ID=DC900048|Name=DC900048|organism=Citrus sinensis|type=EST|length=644bp
GTCCTTCTTGNGTAGAGAGTCTCGTTCTCGATTCTGCGCAGCACACAGAA
TCAGATTTGAGTTAAGTTCTGAAAGAAGAACAAGGAGATCACGAAACAAT
GTCAACACTTACAGTTCCAGCGCAAGTTCCATCTGTTACCGAAGACTGTG
AGCAGCTCAGAAAAGCCTTTGAAGGATGGGGAACAAACGAGCAACTGATC
ATATCGATACTGGCTCACAGAAATGCTGCTCAACGCAAGTTGATTCGACA
AACATATGCTGATACTTACGGCGAAGACCTCCTCAAGTCGCTCGATAAGG
AACTCACTAATGACTTTGAGAGGGTGGTGATGCTCTGGACTCTTGATCCT
GCTGAACGTGATGCCTTTTTGGCTAATGAAGCCACTAAGAGGTGGACTTC
TAGCAACCAGGTTCTTATGGAAATTGCATGCACCAGGTCTTCGAAGCAAT
TGCTCGAAGCAAGGCAGGCTTATCATGCTCGTTTTAAGAAGTCCCTTGAA
GAGGATGTTGGTTATCACACCAATGGGGACTTCCGCAAGCTTTTGCTACC
CTTGTGACTGNCTACCGATATGAGGGTGATGAGGNGACATTACACTTGCA
AATCAGAAGCTAGATTTCATGAGAGATTCGATAGACTACATGAT
back to top