DC900048

Overview
NameDC900048
Unique NameDC900048
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length644
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4158 contig Csv1_Contig4158:7..650. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA2_HUMAN (Annexin A2 OS=Homo sapiens GN=ANXA2 PE=1 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 4.993e-12
Identity = 48/156 (30.77%), Postives = 79/156 (50.64%), Query Frame = 3
Query:   81 QGDHETMSTL--TVPAQVPSVTE-DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            +GDH T  +   +V A      E D   +  A +  G +E  I++IL +R+ AQR+ I   Y     ++L  +L   L+   E V++     PA+ DA     + K   +    L+EI C+R++++L E  + Y   +K  LE+D+   T+GDFRK
Sbjct:   14 EGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRK 169          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA2_PIG (Annexin A2 OS=Sus scrofa GN=ANXA2 PE=1 SV=4)

HSP 1 Score: 70.0922 bits (170), Expect = 1.112e-11
Identity = 47/156 (30.13%), Postives = 79/156 (50.64%), Query Frame = 3
Query:   81 QGDHETMSTL--TVPAQVPSVTE-DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            +GDH T ++   +V A      E D   +  A +  G +E  I++IL +R+  QR+ I   Y     ++L  +L   L+   E V++     PA+ DA     + K   +    L+EI C+R++++L E  + Y   +K  LE+D+   T+GDFRK
Sbjct:   14 EGDHSTPASAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRK 169          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA2_CHICK (Annexin A2 OS=Gallus gallus GN=ANXA2 PE=1 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 1.112e-11
Identity = 46/156 (29.49%), Postives = 75/156 (48.08%), Query Frame = 3
Query:   81 QGDHETMSTLTVPAQVPS---VTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            +GDH    +     +  S      D   L  A +  G +E  II+IL +R+  QR+ I   Y     ++L  +L   L+   E V++     P++ DA     A K   +    L+EI C+R++++L E  + Y   +K  LE+D+   T+GDFRK
Sbjct:   14 EGDHSLPPSAYATVKAYSNFDADRDAAALEAAIKTKGVDEVTIINILTNRSNEQRQDIAFAYQRRTKKELSAALKSALSGHLEAVILGLLKTPSQYDASELKAAMKGLGTDEDTLIEIICSRTNQELNEINRVYREMYKTELEKDIISDTSGDFRK 169          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANX12_COLLI (Annexin A1 isoform p37 OS=Columba livia GN=CP37 PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.112e-11
Identity = 46/144 (31.94%), Postives = 71/144 (49.31%), Query Frame = 3
Query:  114 VPAQVPSV--TEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            VP Q P+   + D   L KA    G +E  II I+  R  AQR  I+  Y    G+ L +++ + L +  E VV+     PA+ DA       K   +    L+EI  +RS+K++ EA + Y    K+ L +D+   T+G F+K
Sbjct:   31 VPQQQPNFDPSADVVALEKAMTAKGVDEATIIDIMTKRTNAQRHRIKAAYQKAKGKSLEEAMKRVLKSHLEDVVVALLKTPAQFDAEELRACMKGLGTDEDTLIEILASRSNKEIREASRYYKEVLKRDLTQDIISDTSGHFQK 174          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: AXA2L_HUMAN (Putative annexin A2-like protein OS=Homo sapiens GN=ANXA2P2 PE=5 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 1.453e-11
Identity = 47/156 (30.13%), Postives = 80/156 (51.28%), Query Frame = 3
Query:   81 QGDHETMSTL--TVPAQVPSVTE-DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            +GDH T  +   +V A      E D   +  A +  G +E  I++I+ +R+ AQR+ I  +Y     ++L  +L   L+   E V++     PA+ DA     + K   +    L+EI C+R++++L E  + Y   +K  LE+D+   T+GDFRK
Sbjct:   14 EGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNIVTNRDNAQRQDIVFSYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRK 169          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA2_SHEEP (Annexin A2 OS=Ovis aries GN=ANXA2 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.453e-11
Identity = 47/156 (30.13%), Postives = 78/156 (50.00%), Query Frame = 3
Query:   81 QGDHETMSTL--TVPAQVPSVTE-DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            +GDH T  +   +V A      E D   +  A +  G +E  I++IL +R+  QR+ I   Y     ++L  +L   L+   E V++     PA+ DA     + K   +    L+EI C+R++++L E  + Y   +K  LE+D+   T+GDFRK
Sbjct:   14 EGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIVSDTSGDFRK 169          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA2_CEREL (Annexin A2 OS=Cervus elaphus GN=ANXA2 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.453e-11
Identity = 47/156 (30.13%), Postives = 78/156 (50.00%), Query Frame = 3
Query:   81 QGDHETMSTL--TVPAQVPSVTE-DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            +GDH T  +   +V A      E D   +  A +  G +E  I++IL +R+  QR+ I   Y     ++L  +L   L+   E V++     PA+ DA     + K   +    L+EI C+R++++L E  + Y   +K  LE+D+   T+GDFRK
Sbjct:   14 EGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIVSDTSGDFRK 169          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA2_BOVIN (Annexin A2 OS=Bos taurus GN=ANXA2 PE=1 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 1.453e-11
Identity = 47/156 (30.13%), Postives = 78/156 (50.00%), Query Frame = 3
Query:   81 QGDHETMSTL--TVPAQVPSVTE-DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            +GDH T  +   +V A      E D   +  A +  G +E  I++IL +R+  QR+ I   Y     ++L  +L   L+   E V++     PA+ DA     + K   +    L+EI C+R++++L E  + Y   +K  LE+D+   T+GDFRK
Sbjct:   14 EGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIVSDTSGDFRK 169          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA2_CANFA (Annexin A2 OS=Canis familiaris GN=ANXA2 PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.897e-11
Identity = 47/156 (30.13%), Postives = 78/156 (50.00%), Query Frame = 3
Query:   81 QGDHETMSTL--TVPAQVPSVTE-DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            +GDH T  +   +V A      E D   +  A +  G +E  I++IL +R+  QR+ I   Y     ++L  +L   L+   E V++     PA+ DA     + K   +    L+EI C+R++++L E  + Y   +K  LE+D+   T+GDFRK
Sbjct:   14 EGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRK 169          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANX2A_XENLA (Annexin A2-A OS=Xenopus laevis GN=anxa2-A PE=2 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 2.478e-11
Identity = 42/133 (31.58%), Postives = 70/133 (52.63%), Query Frame = 3
Query:  141 EDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            +D   +  A +  G +E  II+IL +R+  QR+ I   Y     +DL  +L   L+ + E V++       + DA     + K   +    L+EI C+R++K+LL+ + AY   +K  LE+D+   T+GDFRK
Sbjct:   38 KDAAAIETAIKTKGVDELTIINILTNRSNDQRQDIAFAYHRRTKKDLASALKGALSGNLETVMLGLIKTRPQYDASELKASMKGLGTDEDTLIEIICSRTNKELLDIQNAYRELYKTELEKDIVSDTSGDFRK 170          
The following BLAST results are available for this feature:
BLAST of DC900048 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 84
Match NameE-valueIdentityDescription
ANXA2_HUMAN4.993e-1230.77Annexin A2 OS=Homo sapiens GN=ANXA2 PE=1 SV=2[more]
ANXA2_PIG1.112e-1130.13Annexin A2 OS=Sus scrofa GN=ANXA2 PE=1 SV=4[more]
ANXA2_CHICK1.112e-1129.49Annexin A2 OS=Gallus gallus GN=ANXA2 PE=1 SV=2[more]
ANX12_COLLI1.112e-1131.94Annexin A1 isoform p37 OS=Columba livia GN=CP37 PE... [more]
AXA2L_HUMAN1.453e-1130.13Putative annexin A2-like protein OS=Homo sapiens G... [more]
ANXA2_SHEEP1.453e-1130.13Annexin A2 OS=Ovis aries GN=ANXA2 PE=1 SV=1[more]
ANXA2_CEREL1.453e-1130.13Annexin A2 OS=Cervus elaphus GN=ANXA2 PE=2 SV=1[more]
ANXA2_BOVIN1.453e-1130.13Annexin A2 OS=Bos taurus GN=ANXA2 PE=1 SV=2[more]
ANXA2_CANFA1.897e-1130.13Annexin A2 OS=Canis familiaris GN=ANXA2 PE=1 SV=1[more]
ANX2A_XENLA2.478e-1131.58Annexin A2-A OS=Xenopus laevis GN=anxa2-A PE=2 SV=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900048 VSS Citrus sinensis cDNA clone VS27Q55 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900048 ID=DC900048|Name=DC900048|organism=Citrus sinensis|type=EST|length=644bp
GTCCTTCTTGNGTAGAGAGTCTCGTTCTCGATTCTGCGCAGCACACAGAA
TCAGATTTGAGTTAAGTTCTGAAAGAAGAACAAGGAGATCACGAAACAAT
GTCAACACTTACAGTTCCAGCGCAAGTTCCATCTGTTACCGAAGACTGTG
AGCAGCTCAGAAAAGCCTTTGAAGGATGGGGAACAAACGAGCAACTGATC
ATATCGATACTGGCTCACAGAAATGCTGCTCAACGCAAGTTGATTCGACA
AACATATGCTGATACTTACGGCGAAGACCTCCTCAAGTCGCTCGATAAGG
AACTCACTAATGACTTTGAGAGGGTGGTGATGCTCTGGACTCTTGATCCT
GCTGAACGTGATGCCTTTTTGGCTAATGAAGCCACTAAGAGGTGGACTTC
TAGCAACCAGGTTCTTATGGAAATTGCATGCACCAGGTCTTCGAAGCAAT
TGCTCGAAGCAAGGCAGGCTTATCATGCTCGTTTTAAGAAGTCCCTTGAA
GAGGATGTTGGTTATCACACCAATGGGGACTTCCGCAAGCTTTTGCTACC
CTTGTGACTGNCTACCGATATGAGGGTGATGAGGNGACATTACACTTGCA
AATCAGAAGCTAGATTTCATGAGAGATTCGATAGACTACATGAT
back to top