DC900044

Overview
NameDC900044
Unique NameDC900044
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length488
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12693 contig Csv1_Contig12693:388..876. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900044 vs. ExPASy Swiss-Prot
Match: RL32_DROYA (60S ribosomal protein L32 OS=Drosophila yakuba GN=RpL32 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 2.774e-17
Identity = 43/61 (70.49%), Postives = 49/61 (80.33%), Query Frame = 2
Query:    5 RKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 187
            +KF+VHNV ELE+L+M NR YC EIAH VS+KKRKEIVERA QL V +TN   RLRSQE E
Sbjct:   74 KKFLVHNVRELEVLLMQNRVYCGEIAHGVSSKKRKEIVERAKQLSVRLTNPNGRLRSQENE 134          
BLAST of DC900044 vs. ExPASy Swiss-Prot
Match: RL32_DROSI (60S ribosomal protein L32 OS=Drosophila simulans GN=RpL32 PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 2.774e-17
Identity = 43/61 (70.49%), Postives = 49/61 (80.33%), Query Frame = 2
Query:    5 RKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 187
            +KF+VHNV ELE+L+M NR YC EIAH VS+KKRKEIVERA QL V +TN   RLRSQE E
Sbjct:   74 KKFLVHNVRELEVLLMQNRVYCGEIAHGVSSKKRKEIVERAKQLSVRLTNPNGRLRSQENE 134          
BLAST of DC900044 vs. ExPASy Swiss-Prot
Match: RL32_DROME (60S ribosomal protein L32 OS=Drosophila melanogaster GN=RpL32 PE=1 SV=3)

HSP 1 Score: 87.8113 bits (216), Expect = 2.774e-17
Identity = 43/61 (70.49%), Postives = 49/61 (80.33%), Query Frame = 2
Query:    5 RKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 187
            +KF+VHNV ELE+L+M NR YC EIAH VS+KKRKEIVERA QL V +TN   RLRSQE E
Sbjct:   74 KKFLVHNVRELEVLLMQNRVYCGEIAHGVSSKKRKEIVERAKQLSVRLTNPNGRLRSQENE 134          
BLAST of DC900044 vs. ExPASy Swiss-Prot
Match: RL32_DROAC (60S ribosomal protein L32 OS=Drosophila acanthoptera GN=RpL32 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 4.732e-17
Identity = 43/61 (70.49%), Postives = 49/61 (80.33%), Query Frame = 2
Query:    5 RKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 187
            +KF+VHNV ELE+L+M NR YC EIAH VS+ KRKEIVERA QL V +TN  ARLRSQE E
Sbjct:   74 KKFLVHNVRELEVLLMQNREYCGEIAHGVSSNKRKEIVERAKQLSVRLTNPNARLRSQENE 134          
BLAST of DC900044 vs. ExPASy Swiss-Prot
Match: RL32_DROPS (60S ribosomal protein L32 OS=Drosophila pseudoobscura pseudoobscura GN=RpL32 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 6.181e-17
Identity = 42/61 (68.85%), Postives = 49/61 (80.33%), Query Frame = 2
Query:    5 RKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 187
            +KF+VHNV ELE+L+M NR YC EIAH VS+KKRKEIVERA QL + +TN   RLRSQE E
Sbjct:   74 KKFLVHNVRELEVLLMQNRVYCGEIAHAVSSKKRKEIVERAKQLSIRLTNPNGRLRSQENE 134          
BLAST of DC900044 vs. ExPASy Swiss-Prot
Match: RL32_DROPE (60S ribosomal protein L32 OS=Drosophila persimilis GN=RpL32 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 6.181e-17
Identity = 42/61 (68.85%), Postives = 49/61 (80.33%), Query Frame = 2
Query:    5 RKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 187
            +KF+VHNV ELE+L+M NR YC EIAH VS+KKRKEIVERA QL + +TN   RLRSQE E
Sbjct:   74 KKFLVHNVRELEVLLMQNRVYCGEIAHAVSSKKRKEIVERAKQLSIRLTNPNGRLRSQENE 134          
BLAST of DC900044 vs. ExPASy Swiss-Prot
Match: RL32_DROMI (60S ribosomal protein L32 OS=Drosophila miranda GN=RpL32 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 6.181e-17
Identity = 42/61 (68.85%), Postives = 49/61 (80.33%), Query Frame = 2
Query:    5 RKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 187
            +KF+VHNV ELE+L+M NR YC EIAH VS+KKRKEIVERA QL + +TN   RLRSQE E
Sbjct:   74 KKFLVHNVRELEVLLMQNRVYCGEIAHAVSSKKRKEIVERAKQLSIRLTNPNGRLRSQENE 134          
BLAST of DC900044 vs. ExPASy Swiss-Prot
Match: RL32_DROAZ (60S ribosomal protein L32 OS=Drosophila azteca GN=RpL32 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 6.181e-17
Identity = 42/61 (68.85%), Postives = 49/61 (80.33%), Query Frame = 2
Query:    5 RKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 187
            +KF+VHNV ELE+L+M NR YC EIAH VS+KKRKEIVERA QL + +TN   RLRSQE E
Sbjct:   74 KKFLVHNVRELEVLLMQNRVYCGEIAHAVSSKKRKEIVERAKQLSIRLTNPNGRLRSQENE 134          
BLAST of DC900044 vs. ExPASy Swiss-Prot
Match: RL32_DROAI (60S ribosomal protein L32 OS=Drosophila affinis GN=RpL32 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 6.181e-17
Identity = 42/61 (68.85%), Postives = 49/61 (80.33%), Query Frame = 2
Query:    5 RKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 187
            +KF+VHNV ELE+L+M NR YC EIAH VS+KKRKEIVERA QL + +TN   RLRSQE E
Sbjct:   74 KKFLVHNVRELEVLLMQNRVYCGEIAHAVSSKKRKEIVERAKQLSIRLTNPNGRLRSQENE 134          
BLAST of DC900044 vs. ExPASy Swiss-Prot
Match: RL32_DROSU (60S ribosomal protein L32 OS=Drosophila subobscura GN=RpL32 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 8.072e-17
Identity = 42/61 (68.85%), Postives = 49/61 (80.33%), Query Frame = 2
Query:    5 RKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 187
            +KF+VHNV ELE+L+M NR YC EIAH VS+KKRKEIVERA QL + +TN   RLRSQE E
Sbjct:   74 KKFLVHNVRELEVLLMQNRIYCGEIAHAVSSKKRKEIVERAKQLSIRLTNPNGRLRSQENE 134          
The following BLAST results are available for this feature:
BLAST of DC900044 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 30
Match NameE-valueIdentityDescription
RL32_DROYA2.774e-1770.4960S ribosomal protein L32 OS=Drosophila yakuba GN=... [more]
RL32_DROSI2.774e-1770.4960S ribosomal protein L32 OS=Drosophila simulans G... [more]
RL32_DROME2.774e-1770.4960S ribosomal protein L32 OS=Drosophila melanogast... [more]
RL32_DROAC4.732e-1770.4960S ribosomal protein L32 OS=Drosophila acanthopte... [more]
RL32_DROPS6.181e-1768.8560S ribosomal protein L32 OS=Drosophila pseudoobsc... [more]
RL32_DROPE6.181e-1768.8560S ribosomal protein L32 OS=Drosophila persimilis... [more]
RL32_DROMI6.181e-1768.8560S ribosomal protein L32 OS=Drosophila miranda GN... [more]
RL32_DROAZ6.181e-1768.8560S ribosomal protein L32 OS=Drosophila azteca GN=... [more]
RL32_DROAI6.181e-1768.8560S ribosomal protein L32 OS=Drosophila affinis GN... [more]
RL32_DROSU8.072e-1768.8560S ribosomal protein L32 OS=Drosophila subobscura... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900044 VSS Citrus sinensis cDNA clone VS27Q51 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900044 ID=DC900044|Name=DC900044|organism=Citrus sinensis|type=EST|length=488bp
TTCAAGGAAGTTTGTTGTGCACAATGTCAATGAACTGGAACTCTTGATGA
TGCACAACAGGACTTATTGTGCTGAGATAGCCCACAACGTATCAACCAAG
AAGAGAAAGGAGATTGTCGAGCGTGCTGCACAATTGGATGTTGTGGTCAC
CAACAAATTGGCCAGGTTGCGCAGCCAGGAGGAGGAGTAAAAATTGGTTT
CTATATTGTGTTAGTGTTTGCTTTTTGGCCAAATGTTTCCTAGGTTGTCT
TTGGAATGGATGAACATTTCCAGGGTTGAATTATGATGTATTTTCTATTT
TTGTCACCTGAATGATATTTTGAATTTGTTGTTTTTTGCGGAGCATGATT
AATGTTATGTCAACTTAGGAGTTAAGGTTTATGGCCAAGCCTTTTATTAA
CATTGTTTTGCATATTTTGCCGAAACTATTAGTGGGCAATGTTAAGCGTA
TGATGTTTAATAGCGTTAATTTGTTGACTGTTTCTATT
back to top